| IED ID | IndEnz0018001138 |
| Enzyme Type ID | peroxidase001138 |
| Protein Name |
Phospholipid hydroperoxide glutathione peroxidase, chloroplastic PHGPx EC 1.11.1.12 |
| Gene Name | |
| Organism | Pisum sativum (Garden pea) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Pisum Pisum sativum (Garden pea) |
| Enzyme Sequence | MASMAFSTTFFTPLRDFNQPRTNSTPSTSLPFTKSSIASSKSPFFQLGFSQQASSNFPIVPSKTRSFSVNAKAIKDKTIYDFTVKDIDKKDVSLSKFKGKVLLIVNVASRCGLTSSNYTELSHLYENFKNKGLEVLAFPCNQFGMQEPGSNEEIKQFACTKFKAEFPIFDKVDVNGPFTAPVYQFLKSSSGGFFGDIVKWNFEKFLVDKNGKVVERYPPTTSPFQIEKDIQKLLAA |
| Enzyme Length | 236 |
| Uniprot Accession Number | O24296 |
| Absorption | |
| Active Site | ACT_SITE 111; /evidence=ECO:0000250|UniProtKB:P36968 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O; Xref=Rhea:RHEA:19057, ChEBI:CHEBI:15377, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297, ChEBI:CHEBI:131871, ChEBI:CHEBI:134019; EC=1.11.1.12; Evidence={ECO:0000250|UniProtKB:P36968}; |
| DNA Binding | |
| EC Number | 1.11.1.12 |
| Enzyme Function | FUNCTION: Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. {ECO:0000250|UniProtKB:O70325}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Transit peptide (1) |
| Keywords | Chloroplast;Oxidoreductase;Peroxidase;Plastid;Transit peptide |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast stroma. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 26,400 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:19057 |
| Cross Reference Brenda |