| IED ID | IndEnz0018001157 |
| Enzyme Type ID | peroxidase001157 |
| Protein Name |
Probable phospholipid hydroperoxide glutathione peroxidase PHGPx EC 1.11.1.12 Glutathione peroxidase 2 |
| Gene Name | GPXHA-2 |
| Organism | Helianthus annuus (Common sunflower) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids campanulids Asterales Asteraceae Asteroideae Heliantheae alliance Heliantheae Helianthus Helianthus annuus (Common sunflower) |
| Enzyme Sequence | MATQTVFDFPDDVLQQPPMPADNAFSDKDVKGQDVELSKYKGKVLLIVNVASQCGFTNSNYPELTTLYQKYKDQGFEILAFPCNQFGGQEPGSNEEIQVFACTRFKAEYPVFSKVNVNGKEADPLYKFLKSSKGGFLGDSIKWNFTKFLVDREGKVVDRYAPTTSPLSIEKDIKKLLNVA |
| Enzyme Length | 180 |
| Uniprot Accession Number | O23968 |
| Absorption | |
| Active Site | ACT_SITE 54; /evidence=ECO:0000250|UniProtKB:P36968 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O; Xref=Rhea:RHEA:19057, ChEBI:CHEBI:15377, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297, ChEBI:CHEBI:131871, ChEBI:CHEBI:134019; EC=1.11.1.12; Evidence={ECO:0000250|UniProtKB:P36968}; |
| DNA Binding | |
| EC Number | 1.11.1.12 |
| Enzyme Function | FUNCTION: Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. {ECO:0000250|UniProtKB:O70325}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1) |
| Keywords | Cytoplasm;Oxidoreductase;Peroxidase |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 20,174 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:19057 |
| Cross Reference Brenda |