| IED ID | IndEnz0018001173 |
| Enzyme Type ID | peroxidase001173 |
| Protein Name |
Epididymal secretory glutathione peroxidase EC 1.11.1.9 Epididymis-specific glutathione peroxidase-like protein EGLP Glutathione peroxidase 5 GPx-5 GSHPx-5 Major androgen-regulated protein arMEP24 |
| Gene Name | Gpx5 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MVTELRVFYLVPLLLASYVQTTPRPEKMKMDCYKDVKGTIYDYEALSLNGKEHIPFKQYAGKHVLFVNVATYCGLTIQYPELNALQEDLKPFGLVILGFPCNQFGKQEPGDNLEILPGLKYVRPGKGFLPNFQLFAKGDVNGENEQKIFTFLKRSCPHPSETVVMSKHTFWEPIKVHDIRWNFEKFLVGPDGIPVMRWFHQAPVSTVKSDIMAYLSHFKTI |
| Enzyme Length | 221 |
| Uniprot Accession Number | P21765 |
| Absorption | |
| Active Site | ACT_SITE 73; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 glutathione + H2O2 = glutathione disulfide + 2 H2O; Xref=Rhea:RHEA:16833, ChEBI:CHEBI:15377, ChEBI:CHEBI:16240, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297; EC=1.11.1.9; |
| DNA Binding | |
| EC Number | 1.11.1.9 |
| Enzyme Function | FUNCTION: Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Sequence conflict (7); Signal peptide (1) |
| Keywords | Oxidoreductase;Peroxidase;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10645275; 12211066; 12466851; 14681479; 1787466; 18577359; 18762024; 19303412; 19546506; 21267068; 22719900; 2322385; 24194600; 27317670; 32270769; 7929449; 8566787; 9011320; 9035686; 9110319; 9175627; 9444656; 9640275; |
| Motif | |
| Gene Encoded By | |
| Mass | 25,393 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16833 |
| Cross Reference Brenda |