| IED ID | IndEnz0018001176 |
| Enzyme Type ID | peroxidase001176 |
| Protein Name |
Probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial AtGPX1 PHGPx EC 1.11.1.12 |
| Gene Name | GPX6 GPX1 At4g11600 T5C23.30 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MLRSSIRLLYIRRTSPLLRSLSSSSSSSSSKRFDSAKPLFNSHRIISLPISTTGAKLSRSEHSMAASSEPKSLYDFTVKDAKGNDVDLSIYKGKVLLIVNVASQCGLTNSNYTELAQLYEKYKGHGFEILAFPCNQFGNQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGDKAAPVYKFLKSSKGGLFGDGIKWNFAKFLVDKDGNVVDRFAPTTSPLSIEKDVKKLLGVTA |
| Enzyme Length | 232 |
| Uniprot Accession Number | O48646 |
| Absorption | |
| Active Site | ACT_SITE 105; /evidence=ECO:0000250|UniProtKB:P36968 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O; Xref=Rhea:RHEA:19057, ChEBI:CHEBI:15377, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297, ChEBI:CHEBI:131871, ChEBI:CHEBI:134019; EC=1.11.1.12; Evidence={ECO:0000250|UniProtKB:P36968}; |
| DNA Binding | |
| EC Number | 1.11.1.12 |
| Enzyme Function | FUNCTION: Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. {ECO:0000250|UniProtKB:O70325}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Erroneous initiation (5); Sequence conflict (2); Transit peptide (1) |
| Keywords | Mitochondrion;Oxidoreductase;Peroxidase;Reference proteome;Stress response;Transit peptide |
| Interact With | |
| Induction | INDUCTION: By salt stress, osmotic stress, cold treatment, and metals. Up-regulated by salicylic acid (SA), jasmonic acid (JA), abscisic acid (ABA) and auxin. {ECO:0000269|PubMed:14617062, ECO:0000269|PubMed:9511228, ECO:0000269|Ref.1}. |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12169696; 12885779; 12947053; 13677466; 14551330; 14595688; 14617064; 15060130; 15276431; 15546358; 15890615; 16242667; 16247729; 16258017; 16358359; 16502469; 16547123; 16776300; 16972165; 17122072; 17411438; 17587374; 17644812; 17672910; 17916636; 18055584; 18230142; 18431481; 18493039; 18650403; 18775970; 20584316; 21798377; 21798944; 23615222; 24470466; 28102911; 28627464; 29894956; 31629975; 31887676; 9301122; 9680987; |
| Motif | |
| Gene Encoded By | |
| Mass | 25,584 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:19057 |
| Cross Reference Brenda |