| IED ID | IndEnz0018001188 |
| Enzyme Type ID | peroxidase001188 |
| Protein Name |
Probable glutathione peroxidase 8 GPx-8 GSHPx-8 EC 1.11.1.9 |
| Gene Name | gpx8 zgc:56280 |
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Otomorpha Ostariophysi Otophysi Cypriniphysae Cypriniformes (carps and others) Cyprinoidei Danionidae Danioninae Danio Danio rerio (Zebrafish) (Brachydanio rerio) |
| Enzyme Sequence | MEALGGYPSKSSASRAGLFKVLLSVALCMGSLYLLQNKLSKSRKTKDFYSYEVKDARGRTVSLEKYRGKVSLVVNVASGSELTEQSYRALQELHRELGTSHFNVLAFPCSQYGDTESGTSREIEAFAKSNYGVTFPIFNKIKIMGSEAEPAFRFLTDSVQKIPRWNFWKFLVSPEGQVVRFWKPEEPVSDIRKEATTLVRNIILKKRQEL |
| Enzyme Length | 210 |
| Uniprot Accession Number | Q7ZV14 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 glutathione + H2O2 = glutathione disulfide + 2 H2O; Xref=Rhea:RHEA:16833, ChEBI:CHEBI:15377, ChEBI:CHEBI:16240, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297; EC=1.11.1.9; |
| DNA Binding | |
| EC Number | 1.11.1.9 |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Transmembrane (1) |
| Keywords | Membrane;Oxidoreductase;Peroxidase;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 23684558; |
| Motif | |
| Gene Encoded By | |
| Mass | 23,806 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16833 |
| Cross Reference Brenda |