| IED ID | IndEnz0018001196 |
| Enzyme Type ID | peroxidase001196 |
| Protein Name |
Cuticular glutathione peroxidase EC 1.11.1.9 Cuticular glycoprotein gp29 Major surface antigen gp29 gp30 |
| Gene Name | |
| Organism | Brugia malayi (Filarial nematode worm) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Spirurina Spiruromorpha Filarioidea Onchocercidae Brugia Brugia malayi (Filarial nematode worm) |
| Enzyme Sequence | MSAQLLILSHMVLLQLIVAQLGPKIGKQFLKPKQCEITNQTVYDFQVQMLNGAQKSLAEYRNKVLLIVNVATYCAYTMQYRDFNPILESNSNGTLNILGFPCNQFYLQEPAENHELLSGLKYVRPGHGWEPHKNMHIFGKLEVNGENDHPLYKFLKERCPPTVPVIGKRHQLIYDPIGTNDVIWNFEKFLVDKKGRPRYRFHPENWVQGTAVKPYIDELEREI |
| Enzyme Length | 223 |
| Uniprot Accession Number | P67877 |
| Absorption | |
| Active Site | ACT_SITE 74; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 glutathione + H2O2 = glutathione disulfide + 2 H2O; Xref=Rhea:RHEA:16833, ChEBI:CHEBI:15377, ChEBI:CHEBI:16240, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297; EC=1.11.1.9; |
| DNA Binding | |
| EC Number | 1.11.1.9 |
| Enzyme Function | FUNCTION: Could inhibit the oxidative burst of leukocytes and neutralize the secondary products of lipid peroxidation, thus providing the resistance of these parasites to immune effector mechanisms and their persistence in the mammalian host. It may also be involved in the formation of cross-linking residues such as dityrosine, trityrosine and isotrityrosine identified in cuticular collagen. Highly cross-linked external cortex may also serve to protect the parasite from immune attack. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Glycosylation (2); Signal peptide (1) |
| Keywords | Glycoprotein;Oxidoreductase;Peroxidase;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. Note=Secreted into the cuticle and ultimately released into the medium. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,883 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16833 |
| Cross Reference Brenda |