| IED ID | IndEnz0018001202 |
| Enzyme Type ID | peroxidase001202 |
| Protein Name |
Glutathione peroxidase GPx GSHPx EC 1.11.1.9 |
| Gene Name | GPX1 MC066L |
| Organism | Molluscum contagiosum virus subtype 1 (MOCV) (MCVI) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Molluscipoxvirus Molluscum contagiosum virus Molluscum contagiosum virus subtype 1 (MOCV) (MCVI) |
| Enzyme Sequence | MADGSGARFPRFSELCAKYAAQLAAAETRSVYAFSARPITGGEPVSLGFLRGRVLLIENVASLUGSTVREYTQMNELQRRLGARGLVVLGFPCNQFGHQENAQNAEILPSLKHVRPGNGFEPNFMLFEKCEVNGARAHPLFAFLREALPAPSDDMSTLVSDPQLIAWSPVCRNDVAWNFEKFLVGADGTPVRRYSHRCQTLAVEPDIEALLPPPARGYYA |
| Enzyme Length | 220 |
| Uniprot Accession Number | Q98234 |
| Absorption | |
| Active Site | ACT_SITE 64; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 glutathione + H2O2 = glutathione disulfide + 2 H2O; Xref=Rhea:RHEA:16833, ChEBI:CHEBI:15377, ChEBI:CHEBI:16240, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297; EC=1.11.1.9; |
| DNA Binding | |
| EC Number | 1.11.1.9 |
| Enzyme Function | FUNCTION: May protect the virus and component of infected cells from oxidative damage by peroxides whose formation may be stimulated by infection. {ECO:0000269|PubMed:8670425}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Non-standard residue (1); Site (1) |
| Keywords | Oxidoreductase;Peroxidase;Reference proteome;Selenocysteine |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: During periods of oxidative stress, Sec-64 may react with a superoxide radical, irreversibly lose hydroselenide and be converted to dehydroalanine. {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,218 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16833 |
| Cross Reference Brenda |