| IED ID | IndEnz0018001213 |
| Enzyme Type ID | peroxidase001213 |
| Protein Name |
Dye-decolorizing peroxidase DypB EC 1.11.1.- |
| Gene Name | RER_59910 |
| Organism | Rhodococcus erythropolis (strain PR4 / NBRC 100887) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Nocardiaceae Rhodococcus Rhodococcus erythropolis group Rhodococcus erythropolis (Arthrobacter picolinophilus) Rhodococcus erythropolis (strain PR4 / NBRC 100887) |
| Enzyme Sequence | MALPAIPQPLLTPLTEAAIFLVFTIDEGGEQAVHDVLADISGLQRSIGFRVPAGGLAAVVGIGSDAWDRLFEGPRPAELHPFVELTGDKHHAPRTPGDLLFHIRARQMDLCFEFATVVTNRLAGAASVIDEVHGFKYFEQRDLMGFVDGTENPSGQAAYVAVTVGDEDPDFAGSSYVIVQKYLHDMSEWNSLPVEEQENVIGRSKLEDLEMDDDTKPANSHTALTVIEDESGEQIQILRDNMPFGHVGSAEMGTYFIGYSASPTVTEQMLTNMFIGNPVGNYDRILDFSTAVTGINFFVPTADFLDDPPDAPTRLVPEATFTAPISDGSLGIGSLKRSAQQ |
| Enzyme Length | 341 |
| Uniprot Accession Number | C0ZVK5 |
| Absorption | |
| Active Site | ACT_SITE 148; /note=Proton acceptor; /evidence=ECO:0000250|UniProtKB:Q47KB1 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 1.11.1.- |
| Enzyme Function | FUNCTION: Cargo protein of a type 1 encapsulin nanocompartment (PubMed:24981030). Has both general peroxidase activity and dye-decolorizing activity. Can catalyze the oxidation of both protoporphyrinogen IX and coproporphyrinogen III to their corresponding porphyrins. Also efficiently decolorizes the dyes alizarin red and Cibacron blue F3GA (By similarity). This cargo-loaded encapsulin nanocompartment is probably involved in protection against oxidative damage (By similarity). {ECO:0000250|UniProtKB:I6WZG6, ECO:0000250|UniProtKB:P76536, ECO:0000269|PubMed:24981030}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Metal binding (1); Region (1) |
| Keywords | Encapsulin nanocompartment;Heme;Iron;Metal-binding;Oxidoreductase;Peroxidase |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Encapsulin nanocompartment {ECO:0000269|PubMed:24981030}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 36,959 |
| Kinetics | |
| Metal Binding | METAL 221; /note=Iron (heme proximal ligand); via tele nitrogen; /evidence=ECO:0000250|UniProtKB:Q8XBI9 |
| Rhea ID | |
| Cross Reference Brenda |