| IED ID | IndEnz0018001220 |
| Enzyme Type ID | peroxidase001220 |
| Protein Name |
Glutathione S-transferase D1 EC 2.5.1.18 EC 4.5.1.1 DDT-dehydrochlorinase |
| Gene Name | GstD1 GST Gst1 GSTD1-1 CG10045 |
| Organism | Drosophila melanogaster (Fruit fly) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila melanogaster (Fruit fly) |
| Enzyme Sequence | MVDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPGWEENWAGCLEFKKYFE |
| Enzyme Length | 209 |
| Uniprot Accession Number | P20432 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 10; /note=Glutathione; /evidence=ECO:0000269|PubMed:20417639 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=glutathione + RX = a halide anion + an S-substituted glutathione + H(+); Xref=Rhea:RHEA:16437, ChEBI:CHEBI:15378, ChEBI:CHEBI:16042, ChEBI:CHEBI:17792, ChEBI:CHEBI:57925, ChEBI:CHEBI:90779; EC=2.5.1.18; Evidence={ECO:0000269|PubMed:20417639, ECO:0000269|PubMed:22082028}; CATALYTIC ACTIVITY: Reaction=1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane = 1,1-dichloro-2,2-bis(4-chlorophenyl)ethylene + chloride + H(+); Xref=Rhea:RHEA:19217, ChEBI:CHEBI:15378, ChEBI:CHEBI:16130, ChEBI:CHEBI:16598, ChEBI:CHEBI:17996; EC=4.5.1.1; Evidence={ECO:0000269|PubMed:20417639}; |
| DNA Binding | |
| EC Number | 2.5.1.18; 4.5.1.1 |
| Enzyme Function | FUNCTION: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles (PubMed:22082028, PubMed:20417639). Has DDT dehydrochlorinase activity (PubMed:20417639). May be involved in detoxification (PubMed:22082028). {ECO:0000269|PubMed:20417639, ECO:0000269|PubMed:22082028}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (6); Binding site (1); Chain (1); Domain (2); Erroneous initiation (1); Helix (13); Region (2); Turn (1) |
| Keywords | 3D-structure;Detoxification;Direct protein sequencing;Lyase;Reference proteome;Transferase |
| Interact With | Q9VGA1; Q9VG92 |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 3EIN; 3MAK; |
| Mapped Pubmed ID | 10646799; 10773456; 11095759; 11139510; 11157786; 11259658; 11435138; 11583575; 116125; 11792861; 12118001; 12417656; 12443531; 12547198; 12761875; 1445191; 14595091; 14602080; 14605208; 14680800; 14707262; 15094375; 15096208; 15166145; 15464587; 15710747; 17054780; 1731792; 17907271; 17924685; 18039872; 18077584; 18194654; 18245335; 18628398; 18651915; 19237508; 19342413; 19409416; 19627268; 19649249; 19917591; 20080168; 20184862; 20609461; 21036383; 21108635; 21149573; 21228205; 21295275; 21372148; 21406223; 21423626; 21799256; 21987827; 22065747; 22430022; 22475449; 22940110; 23071443; 23211361; 23226288; 23408904; 23438069; 23521918; 23738891; 23792147; 23944235; 23950728; 24092876; 24141879; 24486154; 24621103; 24974374; 25063457; 25193493; 25281658; 25294943; 25310450; 25426014; 25474322; 25931115; 26158631; 26290570; 26344147; 26526100; 26599788; 26694630; 26715182; 26801178; 26861501; 26911346; 27080728; 27374982; 27514026; 27582081; 27585295; 27701059; 27794539; 28024300; 28184905; 28253732; 28344128; 28434858; 28568827; 28634323; 28660301; 28669604; 29091025; 29245136; 29259189; 29357349; 29375370; 29677000; 30110626; 30263675; 30322073; 30478906; 30658986; 30682390; 30739017; 30770378; 30837466; 3085676; 30974046; 31018943; 3104776; 31425511; 31568497; 31636947; 31841522; 32024668; 32284136; 32291952; 32344153; 32424050; 32598968; 32611818; 32663363; 32773682; 32801000; 33109529; 33264304; 33306674; 33425686; 33474790; 33495633; 33547411; 33563832; 33748138; 33777703; 33909998; 33992327; 34204287; 34216545; 34370733; 34568344; 34605405; 34662537; 34737239; 6439209; 7713409; 7743390; 7775439; 7961718; 8384578; 8580911; 8743688; 8896375; 8913769; 9275195; 9321417; 9342399; 9415093; 9514730; 9533124; 9536439; 9927183; |
| Motif | |
| Gene Encoded By | |
| Mass | 23,866 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=0.23 mM for glutathione {ECO:0000269|PubMed:22082028}; KM=0.45 mM for 1-chloro-2,4-dinitrobenzene {ECO:0000269|PubMed:22082028}; Vmax=84.2 umol/min/mg enzyme with 1-chloro-2,4-dinitrobenzene as substrate {ECO:0000269|PubMed:22082028}; Vmax=7.51 umol/min/mg enzyme with 4-hydroxy-2-nonenal as substrate {ECO:0000269|PubMed:22082028}; Vmax=77 nmol/min/mg enzyme with adrenochrome as substrate {ECO:0000269|PubMed:22082028}; Vmax=0.33 umol/min/mg enzyme with phenethyl isothiocyanate as substrate {ECO:0000269|PubMed:22082028}; Vmax=0.517 umol/min/mg enzyme with prostaglandin A2 as substrate {ECO:0000269|PubMed:22082028}; Vmax=0.012 umol/min/mg enzyme with 5-hydroperoxyeicosatetraenoic acid as substrate {ECO:0000269|PubMed:22082028}; Vmax=0.22 umol/min/mg enzyme with 2-hydroxyethyl disulfide as substrate {ECO:0000269|PubMed:22082028}; |
| Metal Binding | |
| Rhea ID | RHEA:16437; RHEA:19217 |
| Cross Reference Brenda |