| IED ID | IndEnz0018001240 |
| Enzyme Type ID | peroxidase001240 |
| Protein Name |
Chloride intracellular channel protein 2 XAP121 |
| Gene Name | CLIC2 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS |
| Enzyme Length | 247 |
| Uniprot Accession Number | O15247 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Can insert into membranes and form chloride ion channels. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Modulates the activity of RYR2 and inhibits calcium influx. {ECO:0000269|PubMed:15147738, ECO:0000269|PubMed:15916532, ECO:0000269|PubMed:17945253}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (8); Chain (1); Disulfide bond (1); Domain (1); Frameshift (1); Helix (11); Natural variant (1); Region (5); Sequence conflict (2); Transmembrane (1); Turn (4) |
| Keywords | 3D-structure;Chloride;Chloride channel;Cytoplasm;Disease variant;Disulfide bond;Ion channel;Ion transport;Membrane;Mental retardation;Reference proteome;Transmembrane;Transmembrane helix;Transport;Voltage-gated channel |
| Interact With | Q4KMQ1-2 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:15916532}. Membrane {ECO:0000305|PubMed:15916532}; Single-pass membrane protein {ECO:0000305|PubMed:15916532}. Note=Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 2PER; 2R4V; 2R5G; |
| Mapped Pubmed ID | 10830164; 17699613; 17881003; 18007051; 19738201; 20388639; 2298749; 2321095; 2536303; 29198705; 34229297; 7588753; 8809036; 9395096; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,356 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |