| IED ID | IndEnz0018001261 |
| Enzyme Type ID | peroxidase001261 |
| Protein Name |
Plastocyanin major isoform, chloroplastic DNA-damage-repair/toleration protein DRT112 |
| Gene Name | DRT112 At1g20340 F14O10.6 F14O10_4 K3F10TP |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MASVTSATVAIPSFTGLKASTIKSSATVRIQTAAVASPKLTVKSSLKNFGVAAVAAAASIALAGNAMAIEVLLGGGDGSLAFIPNDFSIAKGEKIVFKNNAGYPHNVVFDEDEIPSGVDVAKISMDEQDLLNGAGETYEVALTEPGTYSFYCAPHQGAGMVGKVTVN |
| Enzyme Length | 167 |
| Uniprot Accession Number | P42699 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I. Seems to be the major plastocyanin in Arabidopsis. {ECO:0000269|PubMed:11034343}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Metal binding (4); Sequence conflict (7); Transit peptide (2) |
| Keywords | Chloroplast;Copper;Direct protein sequencing;Electron transport;Membrane;Metal-binding;Plastid;Reference proteome;Thylakoid;Transit peptide;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast thylakoid membrane {ECO:0000269|PubMed:11034343, ECO:0000269|PubMed:11719511, ECO:0000269|PubMed:18431481}; Peripheral membrane protein {ECO:0000269|PubMed:11034343}; Lumenal side {ECO:0000269|PubMed:11034343}. Note=Loosely bound to the chloroplast thylakoid inner membrane surface (PubMed:11034343). |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12376647; 12773541; 12913156; 14576160; 15010610; 15028209; 15208420; 15971193; 16159327; 16500996; 16648217; 16684236; 17163439; 18230142; 18433503; 18633119; 18650403; 19084994; 19403731; 19825610; 20736450; 23802992; 24841956; 28627464; 29362078; |
| Motif | |
| Gene Encoded By | |
| Mass | 16,984 |
| Kinetics | |
| Metal Binding | METAL 105; /note=Copper; via pros nitrogen; /evidence=ECO:0000250|UniProtKB:P18068; METAL 152; /note=Copper; /evidence=ECO:0000250|UniProtKB:P18068; METAL 155; /note=Copper; via pros nitrogen; /evidence=ECO:0000250|UniProtKB:P18068; METAL 160; /note=Copper; /evidence=ECO:0000250|UniProtKB:P18068 |
| Rhea ID | |
| Cross Reference Brenda |