| IED ID | IndEnz0018001277 |
| Enzyme Type ID | peroxidase001277 |
| Protein Name |
Hydroperoxide reductase EC 1.11.1.- |
| Gene Name | MG427 |
| Organism | Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Tenericutes Mollicutes Mycoplasmatales Mycoplasmataceae Mycoplasma Mycoplasma genitalium Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) |
| Enzyme Sequence | MDKKYDITAVLNDDSSINAVSDNFQITLDARPKEKSKGINPLSAFLAGLAACELATANAMAAAKMITLNKALINIKGYRLTNPSDGYFGLRELNIHWEIHSPNEEEEIKEFIDFVSKRCPAHNTLHGTSNFKINISVTLVH |
| Enzyme Length | 141 |
| Uniprot Accession Number | P47666 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 1.11.1.- |
| Enzyme Function | FUNCTION: Reduces organic and inorganic peroxide substrates. Protects the cell against oxidative stress. {ECO:0000269|PubMed:24363346}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Cytoplasm;Oxidoreductase;Peroxidase;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Down-regulated by osmotic shock and ethanol. Not induced by oxidative stress. {ECO:0000269|PubMed:24363346}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:24363346}. Note=A small fraction is associated with the cell membrane. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 15,603 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |