| IED ID | IndEnz0018001325 |
| Enzyme Type ID | peroxidase001325 |
| Protein Name |
1-Cys peroxiredoxin PER1 EC 1.11.1.24 B15C Rehydrin homolog Thioredoxin peroxidase Thioredoxin-dependent peroxiredoxin |
| Gene Name | PER1 |
| Organism | Hordeum vulgare (Barley) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Triticodae Triticeae Hordeinae Hordeum Hordeum vulgare (Barley) |
| Enzyme Sequence | MPGLTIGDTVPNLELDSTHGKIRIHDYVGNGYVILFSHPGDFTPVCTTELAAMANYAKEFEKRGVKLLGISCDDVQSHKEWTKDIEAYKPGSKVTYPIMADPDRSAIKQLNMVDPDEKDAQGQLPSRTLHIVGPDKVVKLSFLYPSCTGRNMDEVVRAVDSLLTAAKHKVATPANWKPGECVVIAPGVSDEEAKKMFPQGFETADLPSKKGYLRFTKV |
| Enzyme Length | 218 |
| Uniprot Accession Number | P52572 |
| Absorption | |
| Active Site | ACT_SITE 46; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:P30041 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtKB:P30041}; |
| DNA Binding | |
| EC Number | 1.11.1.24 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively (By similarity). Seems to contribute to the inhibition of germination during stress (By similarity). {ECO:0000250|UniProtKB:O04005, ECO:0000250|UniProtKB:P30041}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Motif (1) |
| Keywords | Antioxidant;Cytoplasm;Nucleus;Oxidoreductase;Peroxidase;Redox-active center |
| Interact With | |
| Induction | INDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:8180622}. |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:10417721}. Cytoplasm {ECO:0000250|UniProtKB:O04005}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 194..217; /note=Bipartite nuclear localization signal; /evidence=ECO:0000255 |
| Gene Encoded By | |
| Mass | 23,963 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 |
| Cross Reference Brenda |