| IED ID | IndEnz0018001327 |
| Enzyme Type ID | peroxidase001327 |
| Protein Name |
HTH-type transcriptional regulator SkgA Stationary-phase regulation of KatG protein |
| Gene Name | skgA CC_0694 |
| Organism | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Alphaproteobacteria Caulobacterales Caulobacteraceae Caulobacter Caulobacter vibrioides (Caulobacter crescentus) Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) |
| Enzyme Sequence | MSVYTVKQMARLSGVSVRALHHYDAIGLLKPRAVGANGYRYYDRQDLLRLQQILFHRALETPLKDIQAALDQPGFDLAAALRAQRERLAAQAERYARLVDVVDRTLADLEGDETMDDKHLFEGFDPEKQARHEAWLVEHYGDEATRRIADAKAGMKSWGKKDWSQFQEEAKAIEHDLAKALTQGLPVDSAPVTAIMRRHWAWVGRSWNREPTPDAFAGLGHLYQANPEFTARYEAIAPGLTEYFSEAMRAFARGR |
| Enzyme Length | 255 |
| Uniprot Accession Number | P0CAV4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 6..25; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00254 |
| EC Number | |
| Enzyme Function | FUNCTION: Regulates the induction of katG (catalase-peroxidase) in stationary phase. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (1); Chain (1); DNA binding (1); Domain (1); Helix (7); Turn (1) |
| Keywords | 3D-structure;Activator;DNA-binding;Reference proteome;Transcription;Transcription regulation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 7CLA; |
| Mapped Pubmed ID | 33454020; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,965 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |