| IED ID | IndEnz0018001342 | 
| Enzyme Type ID | peroxidase001342 | 
| Protein Name | 
                        
                            
                                Glutathione S-transferase-like protein tpcF  EC 2.5.1.- Trypacidin synthesis protein E  | 
                    
| Gene Name | tpcF tynF AFUA_4G14530 | 
| Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Fumigati Neosartorya fumigata (Aspergillus fumigatus) Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) | 
| Enzyme Sequence | MPDIQPITVYGKGGPNPPRVAIILAELDLPHKVIEVPLSKVKEPDYVAINPNGRIPAIYDPNTDLTLWESGAIVEYLVSHYDPDHRISFPAGSNLAALATQWLFFQASGQGPYYGQASWFKKFHHEKVPSAIERYVKEINRVTGVLEGHLSRQKVAADGDGPWLVGGKCSFADLAWIPWQVIVTAIIQPEDGYTVEDYPHVKNWLDRMMARPGVQKGMADIFPST | 
| Enzyme Length | 225 | 
| Uniprot Accession Number | Q4WQZ2 | 
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 2.5.1.- | 
| Enzyme Function | FUNCTION: Glutathione S-transferase-like protein; part of the gene cluster that mediates the biosynthesis of trypacidin, a mycotoxin with antiprotozoal activity and that plays a role in the infection process (PubMed:26278536, PubMed:26242966). The pathway begins with the synthesis of atrochrysone thioester by the polyketide synthase (PKS) tpcC (PubMed:26242966). The atrochrysone carboxyl ACP thioesterase tpcB then breaks the thioester bond and releases the atrochrysone carboxylic acid from tpcC (PubMed:26242966). The decarboxylase tpcK converts atrochrysone carboxylic acid to atrochrysone which is further reduced into emodin anthrone (PubMed:26242966). The next step is performed by the emodin anthrone oxygenase tpcL that catalyzes the oxidation of emodinanthrone to emodin (PubMed:26242966). Emodin O-methyltransferase encoded by tpcA catalyzes methylation of the 8-hydroxy group of emodin to form questin (PubMed:26242966). Ring cleavage of questin by questin oxidase tpcI leads to desmethylsulochrin via several intermediates including questin epoxide (By similarity). Another methylation step catalyzed by tpcM leads to the formation of sulochrin which is further converted to monomethylsulfochrin by tpcH. Finally, the tpcJ catalyzes the conversion of monomethylsulfochrin to trypacidin (PubMed:26242966). Trypacidin is toxic for human pulmonary and bronchial epithelial cells by initiating the intracellular formation of nitric oxide (NO) and hydrogen peroxide (H(2)O(2)), thus triggering host necrotic cell death (PubMed:22319557). The trypacidin pathway is also able to produce endocrocin via a distinct route from the endocrocin Enc pathway (PubMed:26242966). {ECO:0000250|UniProtKB:Q0CCY0, ECO:0000269|PubMed:22319557, ECO:0000269|PubMed:26242966, ECO:0000269|PubMed:26278536}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Secondary metabolite biosynthesis. {ECO:0000305|PubMed:26278536}. | 
| nucleotide Binding | |
| Features | Chain (1); Domain (2) | 
| Keywords | Reference proteome;Transferase | 
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 25,031 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |