| IED ID | IndEnz0018001357 |
| Enzyme Type ID | peroxidase001357 |
| Protein Name |
1-Cys peroxiredoxin PER1 EC 1.11.1.24 Rehydrin homolog Thioredoxin peroxidase Thioredoxin-dependent peroxiredoxin |
| Gene Name | PER1 At1g48130 F21D18.15 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MPGITLGDTVPNLEVETTHDKFKLHDYFANSWTVLFSHPGDFTPVCTTELGAMAKYAHEFDKRGVKLLGLSCDDVQSHKDWIKDIEAFNHGSKVNYPIIADPNKEIIPQLNMIDPIENGPSRALHIVGPDSKIKLSFLYPSTTGRNMDEVLRALDSLLMASKHNNKIATPVNWKPDQPVVISPAVSDEEAKKMFPQGFKTADLPSKKGYLRHTEVS |
| Enzyme Length | 216 |
| Uniprot Accession Number | O04005 |
| Absorption | |
| Active Site | ACT_SITE 46; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:P30041 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtKB:P30041}; |
| DNA Binding | |
| EC Number | 1.11.1.24 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively (By similarity). Seems to contribute to the inhibition of germination during stress (PubMed:14526116). {ECO:0000250|UniProtKB:P30041, ECO:0000269|PubMed:14526116}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Motif (1); Sequence conflict (5) |
| Keywords | Antioxidant;Cytoplasm;Nucleus;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome;Stress response |
| Interact With | |
| Induction | INDUCTION: By abscisic acid (ABA) and oxidative stress. {ECO:0000269|PubMed:14750521}. |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:14526116}. Cytoplasm {ECO:0000269|PubMed:14526116}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11997378; 12913160; 15356394; 16125897; 16504176; 16606633; 16679420; 16927204; 17346263; 18493039; 20118269; 25266977; 26058145; 27768815; 29439211; 31536657; |
| Motif | MOTIF 191..214; /note=Bipartite nuclear localization signal; /evidence=ECO:0000255 |
| Gene Encoded By | |
| Mass | 24,081 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 |
| Cross Reference Brenda |