| IED ID | IndEnz0018001358 | 
| Enzyme Type ID | peroxidase001358 | 
| Protein Name | 
                        
                            
                                Probable 1-Cys peroxiredoxin  EC 1.11.1.24 Dormancy-associated protein PBS128 Rehydrin homolog Thioredoxin peroxidase Thioredoxin-dependent peroxiredoxin Fragment  | 
                    
| Gene Name | |
| Organism | Bromus secalinus (Rye brome) | 
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Bromeae Bromus Bromus secalinus (Rye brome) | 
| Enzyme Sequence | STHGKIRIHDYVANGYVILFSHPGDFTPVCTTELAAMANYAKEFEKRGVKLLGISCDDVQSHKEWTKDIEAYKPGSKVTYPIMADPDRSAIKQLNMVDPDEKDAEGQLPSRTLHIVGPDKKVKLSFLYPSCTGRNMDEVVRAVDSLLTAAKHKVATPANWKPGECVVIAPGVSDEEAKKLFPQGFETKDLPSKKGYLRFTKV | 
| Enzyme Length | 202 | 
| Uniprot Accession Number | P52571 | 
| Absorption | |
| Active Site | ACT_SITE 30; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:P30041 | 
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtKB:P30041}; | 
| DNA Binding | |
| EC Number | 1.11.1.24 | 
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively (By similarity). Seems to contribute to the inhibition of germination during stress (By similarity). {ECO:0000250|UniProtKB:O04005, ECO:0000250|UniProtKB:P30041}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Motif (1); Non-terminal residue (1) | 
| Keywords | Antioxidant;Cytoplasm;Nucleus;Oxidoreductase;Peroxidase;Redox-active center | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:O04005}. Cytoplasm {ECO:0000250|UniProtKB:O04005}. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | MOTIF 178..201; /note=Bipartite nuclear localization signal; /evidence=ECO:0000255 | 
| Gene Encoded By | |
| Mass | 22,380 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 | 
| Cross Reference Brenda |