| IED ID | IndEnz0018001378 |
| Enzyme Type ID | peroxidase001378 |
| Protein Name |
Glutathione S-transferase F2 AtGSTF2 EC 2.5.1.18 24 kDa auxin-binding protein AtPM24 GST class-phi member 2 |
| Gene Name | GSTF2 PM24.1 At4g02520 T10P11.18 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MAGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ |
| Enzyme Length | 212 |
| Uniprot Accession Number | P46422 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=glutathione + RX = a halide anion + an S-substituted glutathione + H(+); Xref=Rhea:RHEA:16437, ChEBI:CHEBI:15378, ChEBI:CHEBI:16042, ChEBI:CHEBI:17792, ChEBI:CHEBI:57925, ChEBI:CHEBI:90779; EC=2.5.1.18; |
| DNA Binding | |
| EC Number | 2.5.1.18 |
| Enzyme Function | FUNCTION: Binds auxin, endogenous flavonoids and the phytoalexin camalexin and may be involved in regulating the binding and transport of small bioactive natural products and defense-related compounds during plant stress. Binds a series of heterocyclic compounds, including lumichrome, harmane, norharmane and indole-3-aldehyde. In vitro, possesses glutathione S-transferase activity toward 1-chloro-2,4-dinitrobenzene (CDNB) and benzyl isothiocyanate (BITC). Acts as glutathione peroxidase on cumene hydroperoxide, linoleic acid-13-hydroperoxide and trans-stilbene oxide, but not trans-cinnamic acid or IAA-CoA. {ECO:0000269|PubMed:12090627, ECO:0000269|PubMed:21631432}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (7); Chain (1); Domain (2); Helix (14); Region (4); Turn (1) |
| Keywords | 3D-structure;Auxin signaling pathway;Cytoplasm;Detoxification;Direct protein sequencing;Endoplasmic reticulum;Microsome;Oxidoreductase;Peroxidase;Plant defense;Reference proteome;Stress response;Transferase |
| Interact With | |
| Induction | INDUCTION: By ethylene, auxin, glutathione, salicylic acid, copper, paraquat, acetochlor, metolachlor and the pathogens P.syringae and Hyaloperonospora parasitica. {ECO:0000269|PubMed:12090627, ECO:0000269|PubMed:12881503, ECO:0000269|PubMed:14617075, ECO:0000269|PubMed:15069083, ECO:0000269|PubMed:15923336, ECO:0000269|PubMed:8329687}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000269|PubMed:19174456}. Microsome {ECO:0000269|PubMed:19174456}. Endoplasmic reticulum {ECO:0000269|PubMed:19174456}. Note=Plasma membrane vesicles. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (6) |
| Cross Reference PDB | 1BX9; 1GNW; 5A4U; 5A4V; 5A4W; 5A5K; |
| Mapped Pubmed ID | 14535880; 14984929; 15028209; 15159623; 15539469; 16207701; 16361527; 16502469; 17028151; 17075075; 17313162; 17317660; 17432890; 17916636; 18431481; 18467450; 18538804; 18541338; 18633119; 18650403; 19880396; 20442276; 20820802; 21146842; 21333657; 21711359; 22633844; 23083132; 23148892; 23661340; 24962998; 26304848; 28174680; 28627464; 30510558; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,129 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16437 |
| Cross Reference Brenda |