| IED ID | IndEnz0018001387 | 
| Enzyme Type ID | peroxidase001387 | 
| Protein Name | 
                        
                            
                                2-cysteine peroxiredoxin, chloroplastic  2-Cys Prx EC 1.11.1.24 Thiol-specific antioxidant protein Thioredoxin-dependent peroxiredoxin  | 
                    
| Gene Name | |
| Organism | Chattonella marina var. antiqua (Red tide flagellate) (Chattonella antiqua) | 
| Taxonomic Lineage | cellular organisms Eukaryota Sar Stramenopiles Ochrophyta Raphidophyceae Chattonellales Chattonellaceae Chattonella Chattonella marina Chattonella marina var. antiqua (Red tide flagellate) (Chattonella antiqua) | 
| Enzyme Sequence | MSIRVGQKAPDFTATAVFDQEFGTIRLSDYLDKRYVVLFFYPLDFTFVCPTEITAFSDRFKEFKELSTEVLGVSVDSEFSHLAWTQIDRKSGGLGELEYPLVSDLKKEISSSYNVLTEDGVALRALFIIDKEGIIQHSTVNNLSFGRNVDEALRTLQAIQYSQENPDEVCPVNWKPGSKTMKPDPVGSKVYFEAI | 
| Enzyme Length | 195 | 
| Uniprot Accession Number | A0A2Z5VKM8 | 
| Absorption | |
| Active Site | ACT_SITE 49; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000305 | 
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtKB:Q96291}; | 
| DNA Binding | |
| EC Number | 1.11.1.24 | 
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. {ECO:0000250|UniProtKB:Q96291}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (2); Domain (1) | 
| Keywords | Chloroplast;Direct protein sequencing;Disulfide bond;Oxidoreductase;Plastid | 
| Interact With | |
| Induction | INDUCTION: Up-regulated by high-intensity light and H2O2 (Ref.1). Down-regulated in the late stationary growth phase as compared to the early stationary and exponential growth phases (PubMed:23291769). {ECO:0000269|PubMed:23291769, ECO:0000269|Ref.1}. | 
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast {ECO:0000250|UniProtKB:Q96291}. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | Chloroplast | 
| Mass | 22,013 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 | 
| Cross Reference Brenda |