| IED ID | 
                        IndEnz0018001415 | 
                    
                    
                        | Enzyme Type ID | 
                        peroxidase001415 | 
                    
                    
                        | Protein Name | 
                        
                        
                            
                                Soluble secreted antigen MPT53 
                            
                        
                         | 
                    
                    
                        | Gene Name | 
                        mpt53 mpb53 Rv2878c MTCY274.09c | 
                    
                    
                        | Organism | 
                        Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) | 
                    
                    
                        | Taxonomic Lineage | 
                        
                        
                            cellular organisms
                            
                                
                            
                        
                             Bacteria
                            
                                
                            
                        
                             Terrabacteria group
                            
                                
                            
                        
                             Actinobacteria
                            
                                
                            
                        
                             Actinomycetia (high G+C Gram-positive bacteria)
                            
                                
                            
                        
                             Corynebacteriales
                            
                                
                            
                        
                             Mycobacteriaceae
                            
                                
                            
                        
                             Mycobacterium
                            
                                
                            
                        
                             Mycobacterium tuberculosis complex
                            
                                
                            
                        
                             Mycobacterium tuberculosis
                            
                                
                            
                        
                             Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
                            
                        
                         | 
                    
                    
                        | Enzyme Sequence | 
                        MSLRLVSPIKAFADGIVAVAIAVVLMFGLANTPRAVAADERLQFTATTLSGAPFDGASLQGKPAVLWFWTPWCPFCNAEAPSLSQVAAANPAVTFVGIATRADVGAMQSFVSKYNLNFTNLNDADGVIWARYNVPWQPAFVFYRADGTSTFVNNPTAAMSQDELSGRVAALTS | 
                    
                    
                        | Enzyme Length | 
                        173 | 
                    
                    
                        | Uniprot Accession Number | 
                        
                            P9WG65 | 
                        
                    
                    
                        | Absorption | 
                         | 
                    
                    
                        | Active Site | 
                         | 
                    
                    
                        | Activity Regulation | 
                         | 
                    
                    
                        | Binding Site | 
                         | 
                    
                    
                        | Calcium Binding | 
                         | 
                    
                    
                        | catalytic Activity | 
                         | 
                    
                    
                        | DNA Binding | 
                         | 
                    
                    
                        | EC Number | 
                         | 
                    
                    
                        | Enzyme Function | 
                        FUNCTION: Disulfide oxidoreductase that catalyzes the oxidation of reduced, unfolded secreted proteins to form disulfide bonds. Despite a weak homology to thioredoxin this cannot serve as a substrate for thioredoxin reductase. {ECO:0000269|PubMed:14597624}. | 
                    
                    
                        | Temperature Dependency | 
                         | 
                    
                    
                        | PH Dependency | 
                         | 
                    
                    
                        | Pathway | 
                         | 
                    
                    
                        | nucleotide Binding | 
                         | 
                    
                    
                        | Features | 
                        Beta strand (8); Chain (1); Disulfide bond (1); Helix (6); Signal peptide (1) | 
                    
                    
                        | Keywords | 
                        3D-structure;Direct protein sequencing;Disulfide bond;Redox-active center;Reference proteome;Secreted;Signal | 
                    
                    
                        | Interact With | 
                         | 
                    
                    
                        | Induction | 
                         | 
                    
                    
                        | Subcellular Location | 
                        SUBCELLULAR LOCATION: Secreted. | 
                    
                    
                        | Modified Residue | 
                         | 
                    
                    
                        | Post Translational Modification | 
                         | 
                    
                    
                        | Signal Peptide | 
                        SIGNAL 1..38;  /evidence=ECO:0000269|PubMed:10089161 | 
                    
                    
                        | Structure 3D | 
                        X-ray crystallography (1) | 
                    
                    
                        | Cross Reference PDB | 
                        
                            
                            
                                
                                    1LU4;
                                
                            
                                
                            
                             | 
                        
                    
                    
                        | Mapped Pubmed ID | 
                        
                            - | 
                        
                    
                    
                        | Motif | 
                         | 
                    
                    
                        | Gene Encoded By | 
                         | 
                    
                    
                        | Mass | 
                        18,383 | 
                    
                    
                        | Kinetics | 
                         | 
                    
                    
                        | Metal Binding | 
                         | 
                    
                    
                        | Rhea ID | 
                         | 
                    
                    
                        | Cross Reference Brenda | 
                         |