| IED ID | IndEnz0018001417 |
| Enzyme Type ID | peroxidase001417 |
| Protein Name |
Peroxiredoxin-2 Prx EC 1.11.1.25 1-Cys D-peroxiredoxin Glutaredoxin-dependent peroxiredoxin Peroxiredoxin II Thioredoxin peroxidase |
| Gene Name | |
| Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Malpighiales Salicaceae Saliceae Populus (poplars) Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Enzyme Sequence | MAPIAVGDVLPDGKLAYFDEQDQLQEVSVHSLVAGKKVILFGVPGAFTPTCSLKHVPGFIEKAGELKSKGVTEILCISVNDPFVMKAWAKSYPENKHVKFLADGSATYTHALGLELNLQEKGLGTRSRRFALLVDDLKVKAANIEGGGEFTVSSADDILKDL |
| Enzyme Length | 162 |
| Uniprot Accession Number | A9PCL4 |
| Absorption | |
| Active Site | ACT_SITE 51; /note="Cysteine sulfenic acid (-SOH) intermediate"; /evidence="ECO:0000269|PubMed:11832487, ECO:0000305|PubMed:15697201" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[glutaredoxin]-dithiol + a hydroperoxide = [glutaredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62624, Rhea:RHEA-COMP:10729, Rhea:RHEA-COMP:10730, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.25; Evidence={ECO:0000269|PubMed:11706208, ECO:0000269|PubMed:15032877}; |
| DNA Binding | |
| EC Number | 1.11.1.25 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. Plays a role in cell protection against oxidative stress by detoxifying peroxides. {ECO:0000269|PubMed:15032877, ECO:0000269|PubMed:18230180}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Beta strand (10); Chain (1); Domain (1); Helix (6); Mutagenesis (4); Turn (1) |
| Keywords | 3D-structure;Antioxidant;Oxidoreductase;Peroxidase;Redox-active center |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1TP9; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 17,415 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=50 uM for phosphatidylcholine hydroperoxide {ECO:0000269|PubMed:15032877}; |
| Metal Binding | |
| Rhea ID | RHEA:62624 |
| Cross Reference Brenda | 1.11.1.24;1.11.1.25; |