| IED ID |
IndEnz0018001418 |
| Enzyme Type ID |
peroxidase001418 |
| Protein Name |
30S ribosomal protein S13
|
| Gene Name |
rpsM BQ2027_MB3489C |
| Organism |
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Actinobacteria
Actinomycetia (high G+C Gram-positive bacteria)
Corynebacteriales
Mycobacteriaceae
Mycobacterium
Mycobacterium tuberculosis complex
Mycobacterium tuberculosis
Mycobacterium bovis
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
|
| Enzyme Sequence |
MARLVGVDLPRDKRMEVALTYIFGIGRTRSNEILAATGIDRDLRTRDLTEEQLIHLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGMPVRGQRTKTNARTRKGPKRTIAGKKKAR |
| Enzyme Length |
124 |
| Uniprot Accession Number |
P45813 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites. {ECO:0000255|HAMAP-Rule:MF_01315}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Compositional bias (1); Region (1); Sequence conflict (3) |
| Keywords |
RNA-binding;Ribonucleoprotein;Ribosomal protein;rRNA-binding;tRNA-binding |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
14,351 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|