| IED ID | IndEnz0018001439 | 
| Enzyme Type ID | peroxidase001439 | 
| Protein Name | 
                        
                            
                                Hemoglobin subunit beta  Beta-globin Hemoglobin beta chain  | 
                    
| Gene Name | HBB | 
| Organism | Gorilla gorilla gorilla (Western lowland gorilla) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Gorilla Gorilla gorilla (western gorilla) Gorilla gorilla gorilla (Western lowland gorilla) | 
| Enzyme Sequence | MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH | 
| Enzyme Length | 147 | 
| Uniprot Accession Number | P02024 | 
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Involved in oxygen transport from the lung to the various peripheral tissues. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Initiator methionine (1); Metal binding (2); Modified residue (7) | 
| Keywords | Acetylation;Direct protein sequencing;Heme;Iron;Metal-binding;Oxygen transport;Phosphoprotein;Reference proteome;S-nitrosylation;Transport | 
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | MOD_RES 2; /note=N-acetylvaline; /evidence=ECO:0000250|UniProtKB:P02086; MOD_RES 13; /note=Phosphothreonine; /evidence=ECO:0000250|UniProtKB:P68871; MOD_RES 45; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P68871; MOD_RES 60; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:P68871; MOD_RES 83; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:P68871; MOD_RES 94; /note=S-nitrosocysteine; /evidence=ECO:0000250|UniProtKB:P68871; MOD_RES 145; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:P68871 | 
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 15,970 | 
| Kinetics | |
| Metal Binding | METAL 64; /note=Iron (heme b distal ligand); METAL 93; /note=Iron (heme b proximal ligand) | 
| Rhea ID | |
| Cross Reference Brenda |