| IED ID | IndEnz0018001451 | 
| Enzyme Type ID | peroxidase001451 | 
| Protein Name | 
                        
                            
                                Arachidonate 5-lipoxygenase-activating protein  FLAP MK-886-binding protein Fragment  | 
                    
| Gene Name | ALOX5AP FLAP | 
| Organism | Equus caballus (Horse) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Perissodactyla (odd-toed ungulates) Equidae (horses) Equus Equus Equus caballus (Horse) | 
| Enzyme Sequence | MDQETVGNVVLLAIVTLISVIQNGFFAHKVEHESKTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLVMLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERRQSTPGYIFGKRIILFLFLMSLAGIFNYYLILFFGSDFENYIKTITTT | 
| Enzyme Length | 153 | 
| Uniprot Accession Number | P30353 | 
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes (By similarity). {ECO:0000250}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Intramembrane (1); Non-terminal residue (1); Region (2); Topological domain (5); Transmembrane (4) | 
| Keywords | Endoplasmic reticulum;Leukotriene biosynthesis;Membrane;Nucleus;Reference proteome;Transmembrane;Transmembrane helix | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 17,405 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |