| IED ID | IndEnz0018001471 |
| Enzyme Type ID | peroxidase001471 |
| Protein Name |
Group 3 truncated hemoglobin ctb Cj-trHbP Truncated Hb |
| Gene Name | ctb Cj0465c |
| Organism | Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria delta/epsilon subdivisions Epsilonproteobacteria Campylobacterales Campylobacteraceae Campylobacter Campylobacter jejuni Campylobacter jejuni subsp. jejuni Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) |
| Enzyme Sequence | MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAIGTSDEEWKEHKAKIGNFWAGMLLGEGDYNGQPLKKHLDLPPFPQEFFEIWLKLFEESLNIVYNEEMKNVILQRAQMIASHFQNMLYKYGGH |
| Enzyme Length | 127 |
| Uniprot Accession Number | Q0PB48 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 64; /note=Heme |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Has been suggested to be involved in cytochrome c peroxidase or P450-like oxygen chemistry or cyanide detoxification. The high oxygen affinity of this protein suggests that it probably does not function as an oxygen transporter. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (1); Binding site (1); Chain (1); Helix (6); Metal binding (1); Mutagenesis (2) |
| Keywords | 3D-structure;Cytoplasm;Heme;Iron;Metal-binding;Reference proteome;Transport |
| Interact With | |
| Induction | INDUCTION: Constitutively expressed, it is further induced by S-nitrosoglutathione (GSNO) and S-nitroso-N-acetylpenicillamine (SNAP) (at protein level). {ECO:0000269|PubMed:16339953}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305|PubMed:16339953}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 2IG3; |
| Mapped Pubmed ID | 17615063; |
| Motif | |
| Gene Encoded By | |
| Mass | 14,973 |
| Kinetics | |
| Metal Binding | METAL 72; /note=Iron (heme proximal ligand) |
| Rhea ID | |
| Cross Reference Brenda |