| IED ID | IndEnz0018001474 |
| Enzyme Type ID | peroxidase001474 |
| Protein Name |
Probable 1-Cys peroxiredoxin EC 1.11.1.24 Rehydrin Thioredoxin peroxidase Thioredoxin-dependent peroxiredoxin |
| Gene Name | |
| Organism | Syntrichia ruralis (Great hairy screw-moss) (Tortula ruralis) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Bryophyta Bryophytina Bryopsida Dicranidae Pottiales Pottiaceae Syntrichia Syntrichia ruralis (Great hairy screw-moss) (Tortula ruralis) |
| Enzyme Sequence | MGGGWALGDLVPDIQADSTMGHIKVRDYCKDGWTIIFSHPGDYPPVCTTELGKIAAYNPEFEKRGVKLLGLSTDTVEDHQGWIKDIESYTPDAPVLYPILADPDRKITVALNMMDPDEKDANGKPLASRALHIIGPDCRLKLSLLYPGTTGRNFDEVLRVLDSLQLASKHKIATPANWQKGEPVVISPSVSDEKAKQMFPQGWETVNLPKALRMTFVD |
| Enzyme Length | 218 |
| Uniprot Accession Number | P52574 |
| Absorption | |
| Active Site | ACT_SITE 47; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:P30041 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtKB:P30041}; |
| DNA Binding | |
| EC Number | 1.11.1.24 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Seems to contribute to the inhibition of germination during stress (By similarity). Associated with the rehydration events involved in the recovery of the desiccation-tolerant moss (Ref.1). {ECO:0000250|UniProtKB:P30041, ECO:0000269|Ref.1}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1) |
| Keywords | Antioxidant;Cytoplasm;Nucleus;Oxidoreductase;Peroxidase;Redox-active center |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:O04005}. Cytoplasm {ECO:0000250|UniProtKB:O04005}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,085 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 |
| Cross Reference Brenda |