| IED ID | IndEnz0018001484 |
| Enzyme Type ID | peroxidase001484 |
| Protein Name |
Basic salivary proline-rich protein 3 Parotid salivary glycoprotein G1 Proline-rich protein G1 |
| Gene Name | PRB3 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MLLILLSVALLALSSAQSLNEDVSQEESPSVISGKPEGRRPQGGNQPQRTPPPPGKPEGRPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGQPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPHPGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGSPSQGGNKPQGPPPHPGKPQGPPPQEGNKPQRPPPPGRPQGPPPPGGNPQQPLPPPAGKPQGPPPPPQGGRPHRPPQGQPPQ |
| Enzyme Length | 309 |
| Uniprot Accession Number | Q04118 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Acts as a receptor for the Gram-negative bacterium F.nucleatum. {ECO:0000269|PubMed:1894623}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (4); Erroneous translation (1); Glycosylation (10); Modified residue (2); Natural variant (3); Region (2); Repeat (10); Sequence conflict (13); Signal peptide (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Glycoprotein;Phosphoprotein;Pyrrolidone carboxylic acid;Reference proteome;Repeat;Secreted;Signal |
| Interact With | O43681; Q96AL5; P30405; Q96EQ0; Q99961; Q969Z0 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 17; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:20879038; MOD_RES 24; /note=Phosphoserine; /evidence=ECO:0000269|PubMed:20879038 |
| Post Translational Modification | PTM: The Gl-8 variant contains an interchain disulfide bond with salivary peroxidase.; PTM: N- and O-glycosylated; contains about 50% carbohydrate. This is composed of highly fucosylated N-linked saccharides, the major structure is a biantennary asialosaccharide containing 2 fucose residues on one antenna and an unsubstituted terminal lactosamine sequence on the other. The Gram-negative bacterium F.nucleatum binds to carbohydrates containing unsubstituted GalBeta1,4GlcNAc residues. N-glycosylation on Asn-87 is prevalent in head and neck cancer patients. {ECO:0000269|PubMed:1894623, ECO:0000269|PubMed:20879038}.; PTM: Proteolytically cleaved at the tripeptide Xaa-Pro-Gln, where Xaa in the P(3) position is mostly lysine. The endoprotease may be of microbial origin. Besides on the N-terminal of mature PRB3, pyroglutamate formation found on at least Gln-67, Gln-88, Gln-214 and Gln-295. {ECO:0000269|PubMed:18463091}. |
| Signal Peptide | SIGNAL 1..16; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 24135847; |
| Motif | |
| Gene Encoded By | |
| Mass | 30,980 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |