IED ID | IndEnz0018001499 |
Enzyme Type ID | peroxidase001499 |
Protein Name |
Putative peroxiredoxin ycf42 EC 1.11.1.24 Thioredoxin peroxidase |
Gene Name | ycf42 |
Organism | Neopyropia yezoensis (Susabi-nori) (Pyropia yezoensis) |
Taxonomic Lineage | cellular organisms Eukaryota Rhodophyta Bangiophyceae Bangiales Bangiaceae Neopyropia Neopyropia yezoensis (Susabi-nori) (Pyropia yezoensis) |
Enzyme Sequence | MISGPNCLRVGQLAPDFSATAVYDQEFKTLKLSDLKNKYIVLFFYPLDFTFVCPTEITAFSDKYNAFSELNTEVLGVSVDSEYSHLAWLQTDRESGGLGDLSYPLVSDLKKEISAAYNVLNSDGVALRGLFIIDPKGIIQYSTINNLEFGRSVEETLRVLQAIQYVQSHPDEVCPANWKPGDKTMNPDPIKSKNYFAAA |
Enzyme Length | 199 |
Uniprot Accession Number | Q1XDL4 |
Absorption | |
Active Site | ACT_SITE 53; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:Q06830 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtKB:Q06830}; |
DNA Binding | |
EC Number | 1.11.1.24 |
Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. {ECO:0000250|UniProtKB:Q06830}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (1); Chain (1); Disulfide bond (2); Domain (1) |
Keywords | Antioxidant;Chloroplast;Disulfide bond;Oxidoreductase;Peroxidase;Plastid;Redox-active center |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast {ECO:0000305}. |
Modified Residue | |
Post Translational Modification | PTM: The Cys-53-SH group is the primary site of oxidation by H(2)O(2), and the oxidized Cys-53 (probably Cys-SOH) rapidly reacts with Cys-174-SH of the other subunit to form an intermolecular disulfide. This disulfide is subsequently reduced by thioredoxin (By similarity). {ECO:0000250}. |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | Chloroplast |
Mass | 22,181 |
Kinetics | |
Metal Binding | |
Rhea ID | RHEA:62620 |
Cross Reference Brenda |