| IED ID | IndEnz0018001503 | 
| Enzyme Type ID | peroxidase001503 | 
| Protein Name | 
                        
                            
                                Peroxiredoxin-2C  EC 1.11.1.25 Glutaredoxin-dependent peroxiredoxin Peroxiredoxin IIC Thioredoxin peroxidase 2C  | 
                    
| Gene Name | PRXIIC Os01g0675100 LOC_Os01g48420 OJ1117_G01.9 OsJ_002891 P0485G01.43 | 
| Organism | Oryza sativa subsp. japonica (Rice) | 
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) | 
| Enzyme Sequence | MAPVAVGDTLPDGQLGWFDGEDKLQQVSVHGLAAGKKVVLFGVPGAFTPTCSNQHVPGFINQAEQLKAKGVDDILLVSVNDPFVMKAWAKSYPENKHVKFLADGLGTYTKALGLELDLSEKGLGIRSRRFALLADNLKVTVANIEEGGQFTISGAEEILKAL | 
| Enzyme Length | 162 | 
| Uniprot Accession Number | Q9FR35 | 
| Absorption | |
| Active Site | ACT_SITE 51; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:A9PCL4 | 
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[glutaredoxin]-dithiol + a hydroperoxide = [glutaredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62624, Rhea:RHEA-COMP:10729, Rhea:RHEA-COMP:10730, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.25; Evidence={ECO:0000250|UniProtKB:Q9SRZ4}; | 
| DNA Binding | |
| EC Number | 1.11.1.25 | 
| Enzyme Function | FUNCTION: Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system. May be involved in intracellular redox signaling.; FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. {ECO:0000250|UniProtKB:Q9SRZ4}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Initiator methionine (1) | 
| Keywords | Antioxidant;Cytoplasm;Direct protein sequencing;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q9SRZ4}. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 17,291 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62624 | 
| Cross Reference Brenda |