| IED ID | IndEnz0018001504 |
| Enzyme Type ID | peroxidase001504 |
| Protein Name |
Peroxiredoxin-2D EC 1.11.1.25 Glutaredoxin-dependent peroxiredoxin Peroxiredoxin IID Thioredoxin peroxidase 2D |
| Gene Name | PRXIID At1g60740 F8A5.25 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MAPITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFIGKAEELKSKGIDEIICFSVNDPFVMKAWGKTYQENKHVKFVADGSGEYTHLLGLELDLKDKGLGIRSRRFALLLDNLKVTVANVENGGEFTVSSAEDILKAL |
| Enzyme Length | 162 |
| Uniprot Accession Number | O22711 |
| Absorption | |
| Active Site | ACT_SITE 51; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:A9PCL4 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[glutaredoxin]-dithiol + a hydroperoxide = [glutaredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62624, Rhea:RHEA-COMP:10729, Rhea:RHEA-COMP:10730, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.25; Evidence={ECO:0000250|UniProtKB:A9PCL4}; |
| DNA Binding | |
| EC Number | 1.11.1.25 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides (By similarity). May be involved in intracellular redox signaling (Probable). {ECO:0000250|UniProtKB:A9PCL4, ECO:0000305|PubMed:15890615}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Erroneous gene model prediction (1); Sequence conflict (2) |
| Keywords | Antioxidant;Cytoplasm;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305|PubMed:12913160}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11997378; 14500793; 14749482; 15032878; 15632145; 16183842; 16606633; 16709196; 16915352; 17644812; 17828791; 18307990; 18493039; 18650403; 18775970; |
| Motif | |
| Gene Encoded By | |
| Mass | 17,472 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62624 |
| Cross Reference Brenda |