| IED ID | IndEnz0018001505 |
| Enzyme Type ID | peroxidase001505 |
| Protein Name |
Peroxygenase 1 AtPXG1 EC 1.11.2.3 Caleosin-1 Embryo-specific protein 1 ATS1 |
| Gene Name | PXG1 ATS1 CLO1 At4g26740 F10M23.80 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MGSKTEMMERDAMATVAPYAPVTYHRRARVDLDDRLPKPYMPRALQAPDREHPYGTPGHKNYGLSVLQQHVSFFDIDDNGIIYPWETYSGLRMLGFNIIGSLIIAAVINLTLSYATLPGWLPSPFFPIYIHNIHKSKHGSDSKTYDNEGRFMPVNLELIFSKYAKTLPDKLSLGELWEMTEGNRDAWDIFGWIAGKIEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAKIYAGISEDKTAYY |
| Enzyme Length | 245 |
| Uniprot Accession Number | O81270 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by beta-mercaptoethanol and the organophosphorothioate terbufos. {ECO:0000269|PubMed:16956885}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=RH + ROOH = ROH + ROH.; EC=1.11.2.3; Evidence={ECO:0000269|PubMed:16956885}; |
| DNA Binding | |
| EC Number | 1.11.2.3 |
| Enzyme Function | FUNCTION: Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination and in the oxylipin signaling pathways and plant defense responses. Can catalyze sulfoxidation of thiobenzamide, hydroxylation of aniline, epoxidation of oleic acid or intramolecular oxygen transfer. {ECO:0000269|PubMed:16961733}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Domain (1); Initiator methionine (1); Metal binding (5); Modified residue (2); Motif (1); Mutagenesis (13); Sequence conflict (1) |
| Keywords | Acetylation;Calcium;Direct protein sequencing;Disulfide bond;Endoplasmic reticulum;Heme;Iron;Lipid droplet;Membrane;Metal-binding;Microsome;Oxidoreductase;Phosphoprotein;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Not induced by abscisic acid or osmotic stress. {ECO:0000269|PubMed:11197322}. |
| Subcellular Location | SUBCELLULAR LOCATION: Microsome membrane {ECO:0000269|PubMed:11197322}. Lipid droplet {ECO:0000269|PubMed:11197322}. |
| Modified Residue | MOD_RES 2; /note=N-acetylglycine; /evidence=ECO:0000269|PubMed:21751352; MOD_RES 225; /note=Phosphoserine; /evidence=ECO:0000269|PubMed:17582382 |
| Post Translational Modification | PTM: Phosphorylated. Partially phosphorylated at Ser-225, but not phosphorylated at Ser-72, Tyr-145, Thr-166 or Ser-172. Phosphorylation is not required for catalytic activity. {ECO:0000269|PubMed:17582382}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12372144; 12805597; 19220478; 23505340; 24040242; |
| Motif | MOTIF 118..127; /note=Proline-knot |
| Gene Encoded By | |
| Mass | 28,038 |
| Kinetics | |
| Metal Binding | METAL 70; /note=Iron (heme axial ligand); /evidence=ECO:0000305|PubMed:16956885; METAL 75; /note=Calcium; /evidence=ECO:0000255; METAL 77; /note=Calcium; /evidence=ECO:0000255; METAL 79; /note=Calcium; /evidence=ECO:0000255; METAL 86; /note=Calcium; /evidence=ECO:0000255 |
| Rhea ID | |
| Cross Reference Brenda |