| IED ID | IndEnz0018001527 |
| Enzyme Type ID | peroxidase001527 |
| Protein Name |
Peroxiredoxin-4 EC 1.11.1.24 Thioredoxin-dependent peroxiredoxin 4 |
| Gene Name | prdx4 DDB_G0274859 |
| Organism | Dictyostelium discoideum (Slime mold) |
| Taxonomic Lineage | cellular organisms Eukaryota Amoebozoa Evosea Eumycetozoa Dictyostelia (dictyostelid cellular slime molds) Dictyosteliales Dictyosteliaceae Dictyostelium Dictyostelium discoideum (Slime mold) |
| Enzyme Sequence | MRSATKLFKNLSKSVVQLKTVKPVSSLNFGYIKTRQFSTSTTDSSNLFLNNNNQFQNFTFPTKQQIRIRKPAPAFKGQAVVNGEFKEISLDDYKGKYLYLFFYPLDFTFVCPTEIIAFSNAAEEFKKAGCELVGCSIDSPFTHLAWINTPRKEGGLGGINIPLLSDLTHQISKDYGVYIEEDGHTIRGSILIDKEGLVRVITMNDNPVGRSVDEAIRTLKALKFTDQFGEVCPANWSEGDKSMKADPKGSKEYFEAVNK |
| Enzyme Length | 259 |
| Uniprot Accession Number | Q555L5 |
| Absorption | |
| Active Site | ACT_SITE 111; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:Q13162 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtKB:Q13162}; |
| DNA Binding | |
| EC Number | 1.11.1.24 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation. {ECO:0000250|UniProtKB:Q13162}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Alternative sequence (1); Chain (1); Disulfide bond (2); Domain (1) |
| Keywords | Alternative splicing;Antioxidant;Cytoplasm;Disulfide bond;Endoplasmic reticulum;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Up-regulated in gcsA null cells devoid of glutathione. {ECO:0000269|PubMed:18990192}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q13162}. Endoplasmic reticulum {ECO:0000250|UniProtKB:Q13162}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 20422638; 21667333; 22120990; 26888062; |
| Motif | |
| Gene Encoded By | |
| Mass | 29,040 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 |
| Cross Reference Brenda |