| IED ID | IndEnz0018001531 |
| Enzyme Type ID | peroxidase001531 |
| Protein Name |
Mitochondrial import receptor subunit TOM20-4 Translocase of outer membrane 20 kDa subunit 4 |
| Gene Name | TOM20-4 At5g40930 MMG1.2 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MDMQNENERLMVFEHARKVAEATYVKNPLDAENLTRWAGALLELSQFQTEPKQMILEAILKLGEALVIDPKKHDALWLIGNAHLSFGFLSSDQTEASDNFEKASQFFQLAVEEQPESELYRKSLTLASKAPELHTGGTAGPSSNSAKTMKQKKTSEFKYDVFGWVILASYVVAWISFANSQTPVSRQ |
| Enzyme Length | 187 |
| Uniprot Accession Number | P82805 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the translocation pore. {ECO:0000269|PubMed:17981999}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Modified residue (1); Motif (1); Repeat (1); Topological domain (2); Transmembrane (1) |
| Keywords | Acetylation;Direct protein sequencing;Membrane;Mitochondrion;Mitochondrion outer membrane;Protein transport;Reference proteome;TPR repeat;Transmembrane;Transmembrane helix;Transport |
| Interact With | Q9LHE5; O80413; Q07185; Q7DM06 |
| Induction | INDUCTION: Up-regulated after antimycin A or rotenone treatments. {ECO:0000269|PubMed:14730085}. |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion outer membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. |
| Modified Residue | MOD_RES 1; /note=N-acetylmethionine; /evidence=ECO:0000250|UniProtKB:P82874 |
| Post Translational Modification | PTM: The N-terminus is blocked. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10889230; 16331427; 16461275; 16941219; 17151019; 18650403; 18775970; 21798944; 21848659; 22589469; 22863398; 31118221; |
| Motif | MOTIF 179..187; /note=AKR2A-binding sequence (ABS) required for mitochondrion outer membrane targeting; /evidence=ECO:0000269|PubMed:21057222 |
| Gene Encoded By | |
| Mass | 20,973 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |