| IED ID | IndEnz0018001539 |
| Enzyme Type ID | peroxidase001539 |
| Protein Name |
Putative peroxiredoxin-B EC 1.11.1.24 PMP20 Peroxisomal membrane protein B Thioredoxin reductase Thioredoxin-dependent peroxiredoxin-B allergen Cand b 2 |
| Gene Name | PMPB |
| Organism | Candida boidinii (Yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Pichiaceae Ogataea Ogataea/Candida clade Candida boidinii (Yeast) |
| Enzyme Sequence | MAPIKRGDRFPTTDDVYYIPPEGGEPGAFELSKFVKTKKFVVVSVPGAFTPPCTEQHLPGYIKNLPRILSKGVDFVLVITQNDPFVLKGWKKELGAADAKKLIFVSDPNLKLTKKLGSTIDLSSIGLGTRSGRLALIVNRSGIVEYAAIENGGEVDVSTAQKIIAKL |
| Enzyme Length | 167 |
| Uniprot Accession Number | P14293 |
| Absorption | |
| Active Site | ACT_SITE 53; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:P38013 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtKB:P38013}; |
| DNA Binding | |
| EC Number | 1.11.1.24 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. {ECO:0000250|UniProtKB:P38013}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Initiator methionine (1); Motif (1) |
| Keywords | Allergen;Antioxidant;Direct protein sequencing;Membrane;Methanol utilization;Oxidoreductase;Peroxidase;Peroxisome;Redox-active center |
| Interact With | |
| Induction | INDUCTION: By methanol. {ECO:0000269|PubMed:2760051}. |
| Subcellular Location | SUBCELLULAR LOCATION: Peroxisome membrane; Peripheral membrane protein {ECO:0000269|PubMed:2760051}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 165..167; /note=Microbody targeting signal |
| Gene Encoded By | |
| Mass | 18,056 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 |
| Cross Reference Brenda |