| IED ID | IndEnz0018001546 | 
| Enzyme Type ID | peroxidase001546 | 
| Protein Name | 
                        
                            
                                Selenoprotein F  15 kDa selenoprotein  | 
                    
| Gene Name | Selenof Sep15 | 
| Organism | Rattus norvegicus (Rat) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) | 
| Enzyme Sequence | MAAGQGGWLRPALGLRLLLATAFQAVSALGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI | 
| Enzyme Length | 162 | 
| Uniprot Accession Number | Q923V8 | 
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May be involved in redox reactions associated with the formation of disulfide bonds (PubMed:15659830). May contribute to the quality control of protein folding in the endoplasmic reticulum (PubMed:11278576). May regulate protein folding by enhancing the catalytic activity of UGGT1/UGCGL1 and UGGT2/UGCGL2 (By similarity). {ECO:0000250|UniProtKB:O60613, ECO:0000269|PubMed:11278576, ECO:0000269|PubMed:15659830}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-standard residue (1); Signal peptide (1) | 
| Keywords | Endoplasmic reticulum;Reference proteome;Selenocysteine;Signal | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum lumen {ECO:0000269|PubMed:11278576}. Note=The association with UGGT1/UGCGL1 is essential for its retention in the endoplasmic reticulum. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..28; /evidence=ECO:0000255 | 
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | 11344099; 11898406; 16396496; 27752786; | 
| Motif | |
| Gene Encoded By | |
| Mass | 17,822 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |