| IED ID | IndEnz0018001547 |
| Enzyme Type ID | peroxidase001547 |
| Protein Name |
Group 1 truncated hemoglobin GlbN Truncated hemoglobin trHbN Hemoglobin-like protein HbN |
| Gene Name | glbN Rv1542c MTCY48.23 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Enzyme Sequence | MGLLSRLRKREPISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTTAPV |
| Enzyme Length | 136 |
| Uniprot Accession Number | P9WN25 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Binds oxygen cooperatively with very high affinity (P(50) = 0.013 mmHg at 20 degrees Celsius) because of a fast combination (25 microM(-1).sec(-1)) and a slow dissociation (0.2 sec(-1)) rate. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Helix (8); Metal binding (1); Turn (1) |
| Keywords | 3D-structure;Heme;Iron;Metal-binding;Oxygen transport;Reference proteome;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (9) |
| Cross Reference PDB | 1IDR; 1RTE; 1S56; 1S61; 2GKM; 2GKN; 2GL3; 2GLN; 5AB8; |
| Mapped Pubmed ID | 26499089; |
| Motif | |
| Gene Encoded By | |
| Mass | 14,449 |
| Kinetics | |
| Metal Binding | METAL 81; /note=Iron (heme proximal ligand) |
| Rhea ID | |
| Cross Reference Brenda |