| IED ID | IndEnz0018001548 |
| Enzyme Type ID | peroxidase001548 |
| Protein Name |
Peroxiredoxin-2E, chloroplastic EC 1.11.1.25 Glutaredoxin-dependent peroxiredoxin Peroxiredoxin IIE Thioredoxin peroxidase 2E |
| Gene Name | PRXIIE At3g52960 F8J2_130 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MATSLSVSRFMSSSATVISVAKPLLSPTVSFTAPLSFTRSLAPNLSLKFRNRRTNSASATTRSFATTPVTASISVGDKLPDSTLSYLDPSTGDVKTVTVSSLTAGKKTILFAVPGAFTPTCSQKHVPGFVSKAGELRSKGIDVIACISVNDAFVMEAWRKDLGINDEVMLLSDGNGEFTGKLGVELDLRDKPVGLGVRSRRYAILADDGVVKVLNLEEGGAFTNSSAEDMLKAL |
| Enzyme Length | 234 |
| Uniprot Accession Number | Q949U7 |
| Absorption | |
| Active Site | ACT_SITE 121; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:A9PCL4 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[glutaredoxin]-dithiol + a hydroperoxide = [glutaredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62624, Rhea:RHEA-COMP:10729, Rhea:RHEA-COMP:10730, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.25; Evidence={ECO:0000250|UniProtKB:A9PCL4}; |
| DNA Binding | |
| EC Number | 1.11.1.25 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides (By similarity). May be involved in chloroplast redox homeostasis (Probable). {ECO:0000250|UniProtKB:A9PCL4, ECO:0000305|PubMed:15890615}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Modified residue (1); Sequence conflict (1); Transit peptide (1) |
| Keywords | Antioxidant;Chloroplast;Oxidoreductase;Peroxidase;Phosphoprotein;Plastid;Redox-active center;Reference proteome;Transit peptide |
| Interact With | |
| Induction | INDUCTION: Down-regulated by salt stress. {ECO:0000269|Ref.4}. |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast stroma {ECO:0000269|PubMed:12913160}. |
| Modified Residue | MOD_RES 82; /note=Phosphoserine; /evidence=ECO:0007744|PubMed:22092075 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11826309; 11997378; 12529539; 14576160; 15028209; 15032878; 15276439; 15352244; 15998247; 16207701; 16254930; 16606633; 16648217; 16915352; 17028151; 17054949; 17153927; 17163439; 17526915; 18165327; 18210371; 18297659; 18431481; 18493039; 18625226; 18633119; 18650403; 20118269; 20584316; 23448691; 26029221; 27014325; 27247031; 28627464; 28782990; 30833711; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,684 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62624 |
| Cross Reference Brenda |