| IED ID | IndEnz0018001549 |
| Enzyme Type ID | peroxidase001549 |
| Protein Name |
Peroxiredoxin y4vD Prx EC 1.11.1.27 Glutathione-dependent peroxiredoxin |
| Gene Name | NGR_a01200 y4vD |
| Organism | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Alphaproteobacteria Hyphomicrobiales Rhizobiaceae Sinorhizobium/Ensifer group Sinorhizobium Sinorhizobium fredii group Rhizobium fredii (Sinorhizobium fredii) Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
| Enzyme Sequence | MPVKKRVPFVAFRTRVRDETIGGPNPYRWEVRTTEDYFSGKRVVLFSLPGAFTPTCSTQQLPDFERLYDEFGKVGIEAVYCLSVNDAFVMNAWGKALGLEKVRLIPDGSGEFTRKMGMLVAKDNLGFGMRSWRYAAVVNDSVVEQWFEEEGFSDNCESDPYWASSPQNILETLRTFDTARLGRVPIKF |
| Enzyme Length | 188 |
| Uniprot Accession Number | Q53212 |
| Absorption | |
| Active Site | ACT_SITE 56; /note=Cysteine sulfenic acid (-SOH) intermediate (for peroxiredoxin activity); /evidence=ECO:0000250|UniProtKB:P44758 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=a hydroperoxide + 2 glutathione = an alcohol + glutathione disulfide + H2O; Xref=Rhea:RHEA:62632, ChEBI:CHEBI:15377, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297; EC=1.11.1.27; Evidence={ECO:0000250|UniProtKB:P44758}; |
| DNA Binding | |
| EC Number | 1.11.1.27 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. {ECO:0000250|UniProtKB:P44758}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1) |
| Keywords | Antioxidant;Oxidoreductase;Peroxidase;Plasmid;Redox-active center;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | Plasmid sym pNGR234a |
| Mass | 21,432 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62632 |
| Cross Reference Brenda |