| IED ID | IndEnz0018001583 |
| Enzyme Type ID | peroxidase001583 |
| Protein Name |
Peroxiredoxin EC 1.11.1.24 Animal blastomere protein, 25 kDa ABP-25 Thioredoxin peroxidase Thioredoxin-dependent peroxide reductase Thioredoxin-dependent peroxiredoxin |
| Gene Name | |
| Organism | Cynops pyrrhogaster (Japanese fire-bellied newt) (Molge pyrrhogaster) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amphibia Batrachia Caudata Salamandroidea Salamandridae (newts) Pleurodelinae Cynops (firebelly newts) Cynops pyrrhogaster (Japanese fire-bellied newt) (Molge pyrrhogaster) |
| Enzyme Sequence | MSAGKAQIGKPAPEFQAKAVMPGGEFKDIKLADYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFRKINCELIAASVDSHFCHLAWTNTSRKEGGLGSMKIPLVADTKRTISQDYGVLKEDEGISFRGLFIIDDKGILRQITINDLPVGRSVDETLRLVQAFQHTDKFGEVCPAGWKPGSDTIKPDISKSKEYFSKQKA |
| Enzyme Length | 200 |
| Uniprot Accession Number | Q90384 |
| Absorption | |
| Active Site | ACT_SITE 52; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:Q06830 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtKB:Q06830}; |
| DNA Binding | |
| EC Number | 1.11.1.24 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. {ECO:0000250|UniProtKB:Q06830}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (2); Domain (1) |
| Keywords | Antioxidant;Disulfide bond;Oxidoreductase;Peroxidase;Redox-active center |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 22,340 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 |
| Cross Reference Brenda |