| IED ID | IndEnz0018001584 |
| Enzyme Type ID | peroxidase001584 |
| Protein Name |
Group 2 truncated hemoglobin YjbI Truncated Hb trHbO Hemoglobin-like protein YjbI Truncated BHb |
| Gene Name | yjbI BSU11560 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MGQSFNAPYEAIGEELLSQLVDTFYERVASHPLLKPIFPSDLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQTEAEDRSS |
| Enzyme Length | 132 |
| Uniprot Accession Number | O31607 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 45; /note=Heme; BINDING 48; /note=Heme; BINDING 63; /note=Heme |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Hemoglobin-like protein that exhibits a low peroxidase activity. Its very high oxygen affinity may rule out the possibility that it is involved in oxygen transport. {ECO:0000269|PubMed:15866723}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Binding site (3); Chain (1); Helix (8); Metal binding (1); Turn (1) |
| Keywords | 3D-structure;Heme;Iron;Metal-binding;Reference proteome;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1UX8; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 15,116 |
| Kinetics | |
| Metal Binding | METAL 76; /note=Iron (heme proximal ligand) |
| Rhea ID | |
| Cross Reference Brenda |