| IED ID | IndEnz0018001613 |
| Enzyme Type ID | peroxidase001613 |
| Protein Name |
Thioredoxin domain-containing protein 17 14 kDa thioredoxin-related protein TRP14 |
| Gene Name | |
| Organism | Epinephelus coioides (Orange-spotted grouper) (Epinephelus nebulosus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Euteleosteomorpha Neoteleostei Eurypterygia Ctenosquamata Acanthomorphata Euacanthomorphacea Percomorphaceae Eupercaria Perciformes (perches and others) Serranoidei Serranidae (sea basses) Epinephelinae Epinephelini Epinephelus Epinephelus coioides (Orange-spotted grouper) (Epinephelus nebulosus) |
| Enzyme Sequence | MAHYEEVNVRGYDEFCQAVSERKGKDIFAYFSGDKDASGKSWCPDCVTAEPIVRGQMSHLPEGSVFIYCQVGERAYWKDSTNAFKKTLKLSGVPTLLRYGTPQKLVEEECFKADLVRMMFTED |
| Enzyme Length | 123 |
| Uniprot Accession Number | T1SH39 |
| Absorption | |
| Active Site | ACT_SITE 43; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q9BRA2; ACT_SITE 46; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q9BRA2 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions (PubMed:23994424). Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide (By similarity). May function as an antioxidant involved in response to viral infection (PubMed:23994424). {ECO:0000250|UniProtKB:Q9BRA2, ECO:0000269|PubMed:23994424}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (1); Domain (1); Site (2) |
| Keywords | Cytoplasm;Disulfide bond;Redox-active center |
| Interact With | |
| Induction | INDUCTION: Up-regulated in liver in response to Singapore grouper iridovirus (SGIV) infection. 2.8-fold induction after 8 h injection of SGIV and the expression increases up to about 70-fold at 72 hours post injection, then decreases to about 26-fold at 120 h. {ECO:0000269|PubMed:23994424}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q9BRA2}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,009 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |