| IED ID | IndEnz0018001657 |
| Enzyme Type ID | peroxidase001657 |
| Protein Name |
Thioredoxin-like protein Clot Thioredoxin Clot AtClot |
| Gene Name | At5g42850 MBD2.4 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MTLKKVDANPSTLESSLQELKSDETSRSKINFILFLADNDPTTGQSWCPDCVRAEPVIYKTLEEFPEEVKLIRAYAGDRPTWRTPAHPWRVDSRFKLTGVPTLVRWDGDSVKGRLEDHQAHLPHLILPLLAPST |
| Enzyme Length | 134 |
| Uniprot Accession Number | Q9FMN4 |
| Absorption | |
| Active Site | ACT_SITE 48; /note=Nucleophile; /evidence=ECO:0000255; ACT_SITE 51; /note=Nucleophile; /evidence=ECO:0000255 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Probable thiol-disulfide oxidoreductase that may participate in various redox reactions. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (1); Domain (1); Sequence conflict (4) |
| Keywords | Disulfide bond;Electron transport;Redox-active center;Reference proteome;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 16400686; 17031546; 18650403; 28627464; |
| Motif | |
| Gene Encoded By | |
| Mass | 15,206 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |