| IED ID | IndEnz0018001663 |
| Enzyme Type ID | peroxidase001663 |
| Protein Name |
Peroxiredoxin sll1621 Prx EC 1.11.1.27 Glutathione-dependent peroxiredoxin |
| Gene Name | sll1621 |
| Organism | Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Cyanobacteria/Melainabacteria group Cyanobacteria Synechococcales Merismopediaceae Synechocystis unclassified Synechocystis Synechocystis sp. PCC 6803 Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Enzyme Sequence | MTPERVPSVVFKTRVRDESVPGPNPYRWEDKTTEQIFGGKKVVLFSLPGAFTPTCSSNHLPRYEQLFEEFQALGVDDIICLSVNDAFVMFQWGKQIGADKVKLLPDGNGEFTRKMGMLVEKSNLGFGMRSWRYSMFVNDGKIEKMFIEPEFGDNCPVDPFECSDADTMLAYLKGAEAPGVSEPVKAFVG |
| Enzyme Length | 189 |
| Uniprot Accession Number | P73728 |
| Absorption | |
| Active Site | ACT_SITE 55; /note=Cysteine sulfenic acid (-SOH) intermediate (for peroxiredoxin activity); /evidence=ECO:0000250|UniProtKB:P44758 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=a hydroperoxide + 2 glutathione = an alcohol + glutathione disulfide + H2O; Xref=Rhea:RHEA:62632, ChEBI:CHEBI:15377, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297; EC=1.11.1.27; Evidence={ECO:0000250|UniProtKB:P44758}; |
| DNA Binding | |
| EC Number | 1.11.1.27 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. {ECO:0000250|UniProtKB:P44758}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1) |
| Keywords | Antioxidant;Direct protein sequencing;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome |
| Interact With | Itself; P52232; P73263; P52231 |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14673118; 15509585; 16526092; 18000013; 19820102; |
| Motif | |
| Gene Encoded By | |
| Mass | 21,167 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62632 |
| Cross Reference Brenda | 1.11.1.24; |