| IED ID | IndEnz0018001673 |
| Enzyme Type ID | peroxidase001673 |
| Protein Name |
Prostaglandin E synthase mPGES-1 EC 5.3.99.3 Glutathione peroxidase PTGES EC 1.11.1.- Glutathione transferase PTGES EC 2.5.1.18 Inducible prostaglandin E synthase Microsomal prostaglandin E synthase 1 |
| Gene Name | Ptges Pges Pig12 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MTSLGLVMENSQVLPAFLLCSTLLVIKMYAVAVITGQVRLRKKAFANPEDALKRGGLQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKMNPRIRSGAYVLAQFACFSMALQILWEVAHHL |
| Enzyme Length | 153 |
| Uniprot Accession Number | Q9JHF3 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Activity is increased following LPS stimulation and down-regulated by the anti-inflammatory glucocorticoid dexamethasone. {ECO:0000269|PubMed:10869354}. |
| Binding Site | BINDING 39; /note=Glutathione; /evidence=ECO:0000250|UniProtKB:O14684; BINDING 114; /note=Glutathione; /evidence=ECO:0000250|UniProtKB:O14684; BINDING 118; /note=Glutathione; /evidence=ECO:0000250|UniProtKB:O14684 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=prostaglandin H2 = prostaglandin E2; Xref=Rhea:RHEA:12893, ChEBI:CHEBI:57405, ChEBI:CHEBI:606564; EC=5.3.99.3; Evidence={ECO:0000269|PubMed:10869354, ECO:0000269|PubMed:11067848};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:12894; Evidence={ECO:0000250|UniProtKB:O14684}; CATALYTIC ACTIVITY: Reaction=2-glyceryl-prostaglandin H2 = 2-glyceryl-prostaglandin E2; Xref=Rhea:RHEA:53324, ChEBI:CHEBI:85166, ChEBI:CHEBI:137172; Evidence={ECO:0000250|UniProtKB:O14684};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:53325; Evidence={ECO:0000250|UniProtKB:O14684}; CATALYTIC ACTIVITY: Reaction=prostaglandin G2 = (15S)-15-hydroperoxy-prostaglandin E2; Xref=Rhea:RHEA:64364, ChEBI:CHEBI:82629, ChEBI:CHEBI:152564; Evidence={ECO:0000250|UniProtKB:O14684};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:64365; Evidence={ECO:0000250|UniProtKB:O14684}; CATALYTIC ACTIVITY: Reaction=1-chloro-2,4-dinitrobenzene + glutathione = 2,4-dinitrophenyl-S-glutathione + chloride + H(+); Xref=Rhea:RHEA:51220, ChEBI:CHEBI:15378, ChEBI:CHEBI:17996, ChEBI:CHEBI:34718, ChEBI:CHEBI:57925, ChEBI:CHEBI:133977; EC=2.5.1.18; Evidence={ECO:0000250|UniProtKB:O14684}; CATALYTIC ACTIVITY: Reaction=(5S)-hydroperoxy-(6E,8Z,11Z,14Z)-eicosatetraenoate + 2 glutathione = (5S)-hydroxy-(6E,8Z,11Z,14Z)-eicosatetraenoate + glutathione disulfide + H2O; Xref=Rhea:RHEA:48620, ChEBI:CHEBI:15377, ChEBI:CHEBI:57450, ChEBI:CHEBI:57925, ChEBI:CHEBI:58297, ChEBI:CHEBI:90632; Evidence={ECO:0000250|UniProtKB:O14684}; |
| DNA Binding | |
| EC Number | 5.3.99.3; 1.11.1.-; 2.5.1.18 |
| Enzyme Function | FUNCTION: Terminal enzyme of the cyclooxygenase (COX)-2-mediated prostaglandin E2 (PGE2) biosynthetic pathway. Catalyzes the glutathione-dependent oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) in response to inflammatory stimuli (PubMed:10869354, PubMed:11067848). Plays a key role in inflammation response, fever and pain (By similarity). Catalyzes also the oxidoreduction of endocannabinoids into prostaglandin glycerol esters and PGG2 into 15-hydroperoxy-PGE2. In addition, displays low glutathione transferase and glutathione-dependent peroxidase activities, toward 1-chloro-2,4-dinitrobenzene and 5-hydroperoxyicosatetraenoic acid (5-HPETE), respectively (By similarity). {ECO:0000250|UniProtKB:O14684, ECO:0000250|UniProtKB:Q9JM51, ECO:0000269|PubMed:10869354, ECO:0000269|PubMed:11067848}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Lipid metabolism; prostaglandin biosynthesis. {ECO:0000269|PubMed:10869354}. |
| nucleotide Binding | |
| Features | Binding site (3); Chain (1); Region (2); Site (2); Topological domain (4); Transmembrane (4) |
| Keywords | Cytoplasm;Fatty acid biosynthesis;Fatty acid metabolism;Isomerase;Lipid biosynthesis;Lipid metabolism;Membrane;Oxidoreductase;Prostaglandin biosynthesis;Prostaglandin metabolism;Reference proteome;Transferase;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | INDUCTION: Up-regulated after treatment with LPS or in a rat model of adjuvant-induced arthritis (PubMed:10869354, PubMed:11067848). Down-regulated by the anti-inflammatory glucocorticoid dexamethasone (PubMed:10869354). {ECO:0000269|PubMed:10869354, ECO:0000269|PubMed:11067848}. |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane {ECO:0000269|PubMed:11067848}; Multi-pass membrane protein {ECO:0000250|UniProtKB:O14684}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:O14684}. Note=Colocalizes with PTGS1/COX-1 and PTGS2/COX-2 in the perinuclear compartment. {ECO:0000250|UniProtKB:O14684}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12431630; 12707354; 14684572; 15044444; 15284079; 16210398; 16598755; 16621493; 16816110; 17530714; 17927823; 18183617; 18383341; |
| Motif | |
| Gene Encoded By | |
| Mass | 17,273 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:12893; RHEA:12894; RHEA:53324; RHEA:53325; RHEA:64364; RHEA:64365; RHEA:51220; RHEA:48620 |
| Cross Reference Brenda |