| IED ID | IndEnz0018001674 |
| Enzyme Type ID | peroxidase001674 |
| Protein Name |
Probable peroxygenase 4 AtPXG4 EC 1.11.2.3 Caleosin-4 |
| Gene Name | PXG4 CLO4 At1g70670 F5A18.15 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MASSISTGVKFVPEEDNFLQRHVAFFDRNKDGIVYPSETFQGFRAIGCGYLLSAVASVFINIGLSSKTRPGKGFSIWFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEIFTKHAHTHRDALTNEELKQLLKANKEPNDRKGWLAGYTEWKVLHYLCKDKNGLLHKDTVRAAYDGSLFEKLEKQRSSKTSKKHP |
| Enzyme Length | 195 |
| Uniprot Accession Number | Q9CAB7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=RH + ROOH = ROH + ROH.; EC=1.11.2.3; |
| DNA Binding | |
| EC Number | 1.11.2.3 |
| Enzyme Function | FUNCTION: Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination (By similarity). Acts as a negative regulator of abscisic acid responses in non-seed tissues. {ECO:0000250, ECO:0000269|PubMed:21471120}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Metal binding (5); Modified residue (1); Motif (1); Sequence conflict (1) |
| Keywords | Calcium;Heme;Iron;Lipid droplet;Metal-binding;Oxidoreductase;Phosphoprotein;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Down-regulated by abscisic acid and high salt. Not induced by salt stress or desiccation. {ECO:0000269|PubMed:19467604, ECO:0000269|PubMed:21471120}. |
| Subcellular Location | SUBCELLULAR LOCATION: Lipid droplet {ECO:0000305}. |
| Modified Residue | MOD_RES 177; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:O81270 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12372144; 12805597; 15807784; 18775970; 22913587; 23505340; 23517122; 29348626; |
| Motif | MOTIF 70..79; /note=Proline-knot |
| Gene Encoded By | |
| Mass | 22,092 |
| Kinetics | |
| Metal Binding | METAL 22; /note=Iron (heme axial ligand); /evidence=ECO:0000250; METAL 27; /note=Calcium; /evidence=ECO:0000255; METAL 29; /note=Calcium; /evidence=ECO:0000255; METAL 31; /note=Calcium; /evidence=ECO:0000255; METAL 38; /note=Calcium; /evidence=ECO:0000255 |
| Rhea ID | |
| Cross Reference Brenda | 1.11.2.3; |