| IED ID | IndEnz0018001675 |
| Enzyme Type ID | peroxidase001675 |
| Protein Name |
Bidirectional sugar transporter SWEET11 OsSWEET11 Disease resistant allele Xa13 |
| Gene Name | SWEET11 Os8N3 XA13 Os08g0535200 LOC_Os08g42350 OsJ_28080 OSJNBa0033D24.17 P0702C09.32 |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) |
| Enzyme Sequence | MAGGFLSMANPAVTLSGVAGNIISFLVFLAPVATFLQVYKKKSTGGYSSVPYVVALFSSVLWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLVYAPRRARLRTLAFFLLLDVAAFALIVVTTLYLVPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVIKTKSVEFMPIGLSVCLTLSAVAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRKPRNTAVLPTTSDSMSPISAAAAATQRVIELPAGTHAFTILSVSPIPILGVHKVEVVAAEQAADGVAAAAAADKELLQNKPEVIEITAAV |
| Enzyme Length | 307 |
| Uniprot Accession Number | Q6YZF3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. Required for pollen viability. Involved in the transport of copper, in cooperation with COPT1 and COPT2 (PubMed:16648463, PubMed:20852017, PubMed:21107422, PubMed:25988582). {ECO:0000269|PubMed:16648463, ECO:0000269|PubMed:20852017, ECO:0000269|PubMed:21107422, ECO:0000269|PubMed:22157085, ECO:0000303|PubMed:25988582}.; FUNCTION: Confers sensitivity to bacterial blight mediated by X.oryzae pv. oryzae (Xoo) in its Xa13 allelic form (e.g. cv. IR24), probably by providing the sugar required for the pathogen growth, or by reducing copper contents in xylem. However, a recessive resistance can be associated with the xa13 allele (in which the promoter is mutated leading to reduced induction upon pathogen infection, e.g. cv. IRBB13), specifically toward Xoo Philippine race 6 and Indian race PXO8. {ECO:0000269|PubMed:16648463, ECO:0000269|PubMed:16798873, ECO:0000269|PubMed:19318375, ECO:0000269|PubMed:21107422, ECO:0000269|PubMed:23879865, ECO:0000303|PubMed:25988582}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (2); Topological domain (8); Transmembrane (7) |
| Keywords | Cell membrane;Membrane;Plant defense;Reference proteome;Repeat;Sugar transport;Transmembrane;Transmembrane helix;Transport |
| Interact With | |
| Induction | INDUCTION: By the X.oryzae pv. oryzae (Xoo) transcription activator-like effector (TALe) protein pthXo1 and, possibly, AvrXa7. {ECO:0000269|PubMed:16798873, ECO:0000269|PubMed:19318375, ECO:0000269|PubMed:20345643, ECO:0000269|PubMed:23879865}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:20852017, ECO:0000269|PubMed:21107422}; Multi-pass membrane protein {ECO:0000269|PubMed:20852017, ECO:0000269|PubMed:21107422}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11233255; 11590832; 11606550; 14730444; 16328230; 17307154; 17563377; 17601161; 19253322; 20349335; 21098734; 21793000; 22189605; 22218673; 22869552; 23125910; 23430045; 23430047; 23690028; 23999092; 24312391; 26054243; 26483798; 26566849; 26976728; 26991395; 27001973; 27330561; 27403778; 27468288; |
| Motif | |
| Gene Encoded By | |
| Mass | 32,978 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |