| IED ID | IndEnz0018001680 |
| Enzyme Type ID | peroxidase001680 |
| Protein Name |
Probable peroxiredoxin prdx-3 EC 1.11.1.24 Thiol-specific antioxidant protein Thioredoxin peroxidase Thioredoxin-dependent peroxide reductase Thioredoxin-dependent peroxiredoxin 1 |
| Gene Name | prdx-3 R07E5.2 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MFSSAVRALCRTVPTVATRQLSTSRALLSLRPLGPKNTVPAFKGTAVVDGDFKVISDQDYKGKWLVMFFYPLDFTFVCPTEIIAYGDRANEFRSLGAEVVACSCDSHFSHLAWVNTPRKDGGLGDMDIPLLADFNKKIADSFGVLDKESGLSYRGLFLIDPSGTVRHTTCNDLPVGRSVDETLRVLKAFQFSDKHGEVCPADWHEDSPTIKPGVATSKEYFNKVNK |
| Enzyme Length | 226 |
| Uniprot Accession Number | Q21824 |
| Absorption | |
| Active Site | ACT_SITE 78; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:Q06830 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O; Xref=Rhea:RHEA:62620, Rhea:RHEA-COMP:10698, Rhea:RHEA-COMP:10700, ChEBI:CHEBI:15377, ChEBI:CHEBI:29950, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:50058; EC=1.11.1.24; Evidence={ECO:0000250|UniProtKB:Q06830}; |
| DNA Binding | |
| EC Number | 1.11.1.24 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. {ECO:0000250|UniProtKB:Q06830}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (2); Domain (1) |
| Keywords | Antioxidant;Disulfide bond;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 16673436; 19064914; 21085631; 21177967; 22560298; 22921415; 23604319; 23722165; 23800452; 25487147; 26009280; 26255886; 26351692; 27506200; 30036395; 30353013; 31216475; 31283754; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,932 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62620 |
| Cross Reference Brenda | 1.11.1.24; |