| IED ID | IndEnz0018001695 |
| Enzyme Type ID | peroxidase001695 |
| Protein Name |
Glutathione S-transferase YfcF EC 2.5.1.18 |
| Gene Name | yfcF b2301 JW2298 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MSKPAITLWSDAHFFSPYVLSAWVALQEKGLSFHIKTIDLDSGEHLQPTWQGYGQTRRVPLLQIDDFELSESSAIAEYLEDRFAPPTWERIYPLDLENRARARQIQAWLRSDLMPIREERPTDVVFAGAKKAPLTAEGKASAEKLFAMAEHLLVLGQPNLFGEWCIADTDLALMINRLVLHGDEVPERLVDYATFQWQRASVQRFIALSAKQSG |
| Enzyme Length | 214 |
| Uniprot Accession Number | P77544 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: GSH transferase activity is inhibited by S-hexyl glutathione. {ECO:0000269|PubMed:17018556}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=glutathione + RX = a halide anion + an S-substituted glutathione + H(+); Xref=Rhea:RHEA:16437, ChEBI:CHEBI:15378, ChEBI:CHEBI:16042, ChEBI:CHEBI:17792, ChEBI:CHEBI:57925, ChEBI:CHEBI:90779; EC=2.5.1.18; Evidence={ECO:0000269|PubMed:17018556}; |
| DNA Binding | |
| EC Number | 2.5.1.18 |
| Enzyme Function | FUNCTION: Exhibits glutathione (GSH) S-transferase activity toward 1-chloro-2,4-dinitrobenzene (CDNB); however this activity is as low as 1% of that of GstA. Also displays a GSH-dependent peroxidase activity toward cumene hydroperoxide. Is involved in defense against oxidative stress, probably via its peroxidase activity. {ECO:0000269|PubMed:17018556}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Activity decreases as pH is lowered from neutral to acidic. {ECO:0000269|PubMed:17018556}; |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Domain (2); Helix (9); Mutagenesis (2); Turn (3) |
| Keywords | 3D-structure;Oxidoreductase;Peroxidase;Reference proteome;Transferase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 3BBY; |
| Mapped Pubmed ID | 16606699; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,326 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=0.24 mM for glutathione {ECO:0000269|PubMed:17018556}; KM=1.1 mM for 1-chloro-2,4-dinitrobenzene {ECO:0000269|PubMed:17018556}; Note=kcat is 0.11 sec(-1) for the GSH transferase reaction with CDNB as substrate.; |
| Metal Binding | |
| Rhea ID | RHEA:16437 |
| Cross Reference Brenda |